SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018326 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018326
Domain Number 1 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 637-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 582-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 525-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 360-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.06e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 693-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 288-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000099
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 254-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000549
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018326   Gene: ENSOCUG00000024463   Transcript: ENSOCUT00000032148
Sequence length 744
Comment pep:novel chromosome:OryCun2.0:9:43193546:43223408:1 gene:ENSOCUG00000024463 transcript:ENSOCUT00000032148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSPVLVSFEDVAVDFSWEEWQNLDNAQRTLYRDVMLEIYSNLLSLGYCITKPEVIFKL
EQGAEPWIVEGPLSPSLPAVQKMDNLIKASQESQDGYISQAATTNNNTSTEERIELGKAL
HLSSNNIPKLNTKSGSYSGLRPEAFNLYKNAIHPSEPDEMHAGEKPNAYSITGKLHGYPE
HHSQHQKIQTLKQTFEHREGKVFNRDTISFTHKRAHMGVTLSKCNEDRNAYSKSAVTGET
TNIGKKTIYKKSALFKQQTYTEEKTSECTEYEELFISKSDLTVSERTHTGKKPYACNLYE
KSFSCKTKLGIHHRIHTGGKPHGCNKCGKTFFQKSHPGMLQIIHKGEKLCECNEFGKTCQ
RSHLNKHQRTHTREKPFKCNECGKIFSQKSVLSVHQRIHTGEKPFGCNDCGKTFGQKSHL
SVHQRTHTGEKPFECNECGKTFAQKSVLTVHQRTHTGEKPYECSECGKTFCQKSVLTIHL
RTHTGEKPYECCECGKTFCRKSKLSMHQRIHTGEKPYVCNQCGKTFYHKSVLSMHQRTHK
REKPYECNECGKTFYQKSDLMIHQRIHTGEKPYECKECGKIFCQKSHLIKHQRIHTGEKP
FECSECGKTFSRKSSLRMHQRTHTGEKPYKCIECRKTFSHKSGLTIHQRTHTGEKPYECH
ECGKTFCRKSFLNTHQRTHTGEKPYECNECGKTFGQKSHLRTHLRTHTGEKPFECTECGR
TFGQKSHLRTHQRTHTVEKPFECK
Download sequence
Identical sequences G1TMW1
ENSOCUP00000018326 XP_008259165.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]