SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018806 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018806
Domain Number 1 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 521-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 309-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 100-150
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 7 Region: 272-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000653
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018806   Gene: ENSOCUG00000024037   Transcript: ENSOCUT00000024578
Sequence length 578
Comment pep:novel chromosome:OryCun2.0:19:4270964:4289519:-1 gene:ENSOCUG00000024037 transcript:ENSOCUT00000024578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDSELAQEVRSLCQARDGRSPRGKAARTTARPPRASDCSACPVLSWGEAQHLRGMEEAV
VMETELAEMPERRALSFQESPLSQEKSAEGGEVAALRLTARSQTTVTFKDVAMDFTPEEW
GKLDPTQRAVMLENYRNLVSLWLPISKPESYDVENGKEPLTLERKVPSSSYPDVETRPKS
KDSTSVQDFSKEDSCQVAIIERLTKNNGLETALECDSWLENQQGSQERHLREMFTHMNSL
PEERDHEHDVYWENYSQKSVLTTQDRVPKGSYSFHTLDKRLKQKSNLMKKQRTFKEKKPH
KCNDCGELFTYHSVLIRHQRVHTGEKPYTCSECGKSFSHRANLTKHQRTHTRILFECNEC
KKTFTESSSLAIHQRIHIGERPYECSECGKGFNRSTHLVQHQLIHTGVKPYECNECDKAF
IHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFSQST
HLVQHQRIHTGEKPYECSECGKTFSRSSNFAKHQRIHIGKKPYKCSECGKAFIHSSALIQ
HQRTHTGEKPFRCNECGKSFKCSSSLIRHQRIHTEEQP
Download sequence
Identical sequences G1TP74
XP_008268918.1.1745 ENSOCUP00000018806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]