SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019146 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019146
Domain Number 1 Region: 30-124
Classification Level Classification E-value
Superfamily Snake toxin-like 9.06e-24
Family Extracellular domain of cell surface receptors 0.037
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000272
Family Extracellular domain of cell surface receptors 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019146   Gene: ENSOCUG00000027050   Transcript: ENSOCUT00000028609
Sequence length 352
Comment pep:known_by_projection scaffold:OryCun2.0:GL019267:29856:32372:1 gene:ENSOCUG00000027050 transcript:ENSOCUT00000028609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARKAGGPAGVRRAGWLLFLPLLCLQAGAQALECYSCVQQADDGCAPHRMKTVTCAPG
IDVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNVKL
NLTSRALDPAGNESAYEPNGVECYSCVGRSREACQGTAPPVVSCYNASDRVYKGCFDGNV
TLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPP
LVLLTPPSTAAAPATRASSSSAPSTPAATARPSTAKPTPAPTSHTTAQEVEVEAPREEEP
RLAGGVAGHQDRRNMGQYPAKGGTQYPSNRGVAAPATGLALLVWAVAAGALL
Download sequence
Identical sequences G1TQ55
9986.ENSOCUP00000019146 ENSOCUP00000019146 ENSOCUP00000019146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]