SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021298 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021298
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.49e-28
Family Hormone receptor domain 0.0000792
Further Details:      
 
Domain Number 2 Region: 90-386
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000201
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021298   Gene: ENSOCUG00000025701   Transcript: ENSOCUT00000025599
Sequence length 415
Comment pep:known chromosome:OryCun2.0:19:46187475:46222123:1 gene:ENSOCUG00000025701 transcript:ENSOCUT00000025599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRPQLPLVKALLLLGLNPVSASLQDQHCESLSPASNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSACQEILNEEKKSKVHYHVAV
IINYLGHCVSLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEV
HQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVHPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSVKQSTAL
Download sequence
Identical sequences G1TW55
ENSOCUP00000021298 9986.ENSOCUP00000021298 ENSOCUP00000021298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]