SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021968 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021968
Domain Number 1 Region: 172-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000318
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000021968
Domain Number - Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000411
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 209-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 33-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0857
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021968   Gene: ENSOCUG00000026936   Transcript: ENSOCUT00000025792
Sequence length 325
Comment pep:known_by_projection scaffold:OryCun2.0:GL018904:436649:446511:1 gene:ENSOCUG00000026936 transcript:ENSOCUT00000025792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTYGAECFPACDPQNGFCEDDNVCRCQPGWQGPLCDQCETS
PGCVNGLCEDPWQCICKEGWDGKLCDIDVRACTSAPCANNGTCVNLDGGLYECSCVAGFS
GKQCQHKAGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVATSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVANCASSPCQNGGTCLQHTQVSMKELNRSTPL
LTEGQAICFTVLGVLTSLVVLGTVGIIFLNKCEAWVSSLRYNHTLRKKQNLLLQYNSGED
LAVNIIFPEKIDMATFSKEAGEEEI
Download sequence
Identical sequences G1TY09
ENSOCUP00000021968 XP_017194746.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]