SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022070 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022070
Domain Number 1 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 193-243
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000131
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000022070
Domain Number - Region: 105-172
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022070   Gene: ENSOCUG00000008423   Transcript: ENSOCUT00000021965
Sequence length 658
Comment pep:known_by_projection chromosome:OryCun2.0:7:2831875:2860933:-1 gene:ENSOCUG00000008423 transcript:ENSOCUT00000021965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTEISLWTVVAAIQAVERKVDAQASQLLN
LEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENMENLLRNRNFW
VLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLDSEG
SVPKPDPPAQVEPREEPCVWEQRHPEERDVPMDPNTGAEPLVPAQDTSSQVKREEALCVR
GQRGLEDRAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLAERDIPTDPNSESLISA
HDILSWIKQEEQPYPWGPRDSVEGELGLDSGPSDSLLLVKNPPPAPPPAPPQPQPHQQSL
PSLPVAENPGGPPSRGLLEDDFPVLPGERGGGEAQPGGEGGAGGGGGGGGTSAGAGAGAG
GSCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSHTKERPYECAECEK
SFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCALCGKSFIR
KQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGLGAPRPQQAPPERD
Download sequence
Identical sequences G1TYA8
ENSOCUP00000022070 9986.ENSOCUP00000022070 ENSOCUP00000022070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]