SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022176 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022176
Domain Number 1 Region: 247-317
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-17
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 166-268
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000116
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022176   Gene: ENSOCUG00000026966   Transcript: ENSOCUT00000022665
Sequence length 380
Comment pep:known_by_projection chromosome:OryCun2.0:X:104213658:104227972:1 gene:ENSOCUG00000026966 transcript:ENSOCUT00000022665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSAVP
IPEDAGKSSKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTLEEGSASPTSPDCSLDS
PGPEKMALAFSEQEERELPALSRQASTSSELCSPSPGSGSFGEEAPAPPYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKLGSFKFIYVDVLPEEAVGPA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNITDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRD
EVDLAGTEEQLHSLSLAGAP
Download sequence
Identical sequences G1TYL1
ENSOCUP00000022176 9986.ENSOCUP00000022176 XP_002720333.1.1745 ENSOCUP00000022176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]