SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024287 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024287
Domain Number 1 Region: 331-495
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.23e-40
Family Dual specificity phosphatase-like 0.0000182
Further Details:      
 
Domain Number 2 Region: 506-639
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-37
Family PLC-like (P variant) 0.0019
Further Details:      
 
Domain Number 3 Region: 189-320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000282
Family Voltage-gated potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024287   Gene: ENSOCUG00000024145   Transcript: ENSOCUT00000025349
Sequence length 640
Comment pep:novel scaffold:OryCun2.0:GL018705:1994007:2059107:1 gene:ENSOCUG00000024145 transcript:ENSOCUT00000025349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRFKKNRQYRWFSRKKNTNTSNPKETTPITYVESINDISNSEDSKSITDVESIRDNPSS
NDLMPVAFDGVTNETTTVYEFTSTSWEGAISEILNTEELASDTHEEVPNTINVLYESESS
GRKTKAISPSRGPAPFGEVINEITVQSDLKTSPSECTSTTLSESTAISVDEGVDETSRIK
NIARLIVSSFAFRVFGILLIFVDIFLIMSDVLFNENTMVLELRSASLAIALFFCFDVLLS
VYVEGRKQYFSDLFNTLDAVIIAITLVIDIIYFFFELRILKDIPRLAVLLRPLRLVILIR
VFHLAYQKRQLEKLTRRLVSGNKRRYNRDGFDLDLTYVTDRIIAMSFPSSGKQSFYRNPI
KEVVKFLDTKHPNHYRVYNLCSEKAYDPEYFHNRVQRIMIDDHNVPTLSEMVVFAKEVNM
WLAQDKENVVVIHCKGGKGRTGTMVCVCLIANQLFGTAEDSLSFFGHQRIDQTTSTKYHG
VETPSQHRYVGYFEKVKRLHHWTLPPRKILQPNKIIIHSIHSVGKGDGSDLKIQIITMQQ
TVFSCSSSKNCKIFHDVETDRVIIELLNCPILYDDVKVRFLSRNLPKYYDKCAFFFWFNT
AFIQNNRLYLRRNELDNPHKRKAWKTYGPRFAVEIYFNTT
Download sequence
Identical sequences G1U4G6
ENSOCUP00000024287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]