SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024661 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024661
Domain Number 1 Region: 903-1098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000303
Further Details:      
 
Domain Number 2 Region: 19-156
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-20
Family PDZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 690-824
Classification Level Classification E-value
Superfamily PH domain-like 4.69e-17
Family Pleckstrin-homology domain (PH domain) 0.0000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024661   Gene: ENSOCUG00000011758   Transcript: ENSOCUT00000023110
Sequence length 1201
Comment pep:known_by_projection chromosome:OryCun2.0:19:39963833:40010423:1 gene:ENSOCUG00000011758 transcript:ENSOCUT00000023110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHRARIPAAGAPSTLSPCAPQLPLGPRDGCSPGRPPPWQGPRTLLLRKSLQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRHRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSDDVLELAIMPKDEDILQLAYSQDAYLKGNQPYSGEAR
SIPEPPPVCYPRKSYAPPARVSAWATMVPEPVSALPNDPRSPAAWSDQGPRVPAATRAHP
DNSCLGMSQPRPSPGAFPNLPSESRTPRAFPEPGSRVPPSRRQCQQALSHWLSNQVPRRA
GERRCPAMPPRARSASQDRLEDVTAHRPWPCSTSQDALSQLGQEGWHRARSDDYLGRATR
SAEALGPGALVPRLERCGWASQRPAARTSACPSRDLPGPQAAPLSGLQGLDDVGYIGYRS
YSPSFQRRTGLLHALSFRDSPFGGLPSFSLAQTPAPFPPEASEPAARVVRPEPSPRALEP
PTEDHRDEVVLRQKPPTGRKVQLTPARQANLGIGDETPEPEPSGRGPRLGRKVAPLATTE
DSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALGRHYSQD
CSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRVPSLRMLRSFFTDGSL
DSWGTSEDAEAPSKRPSTSDLSDANFSDIRREGWLYYKQILTKKGKKMGWGGEEWLGGHS
ATTAGQLALAEQERQEPGPAATEAATAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLT
TADFCEYLFQAEDRDDMLSWIRAIRENSRAEGEDPGCANQALISKKLNEYRKVSHSSGPK
ADSSPKGSRGLGGLKSEFLKQSAARGLRTQELPAAGKDDSAAAPKTPWGINIIKKNKKAA
PRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNR
GPSDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMKTLRK
LIRDLPAHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHM
PDRYKIVETLIQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDPGSA
TDSTTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEA
H
Download sequence
Identical sequences G1U5I1
ENSOCUP00000024661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]