SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024691 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024691
Domain Number 1 Region: 757-850
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-23
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 1044-1138
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-22
Family I set domains 0.0043
Further Details:      
 
Domain Number 3 Region: 853-946
Classification Level Classification E-value
Superfamily Immunoglobulin 9.9e-21
Family I set domains 0.0036
Further Details:      
 
Domain Number 4 Region: 119-213
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 1140-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 6.92e-20
Family I set domains 0.0063
Further Details:      
 
Domain Number 6 Region: 948-1042
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-19
Family I set domains 0.0033
Further Details:      
 
Domain Number 7 Region: 310-404
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 214-306
Classification Level Classification E-value
Superfamily Immunoglobulin 9.14e-16
Family I set domains 0.0089
Further Details:      
 
Domain Number 9 Region: 664-754
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000126
Family I set domains 0.004
Further Details:      
 
Domain Number 10 Region: 26-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000458
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 403-486
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000871
Family I set domains 0.016
Further Details:      
 
Domain Number 12 Region: 570-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000003
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024691   Gene: ENSOCUG00000009769   Transcript: ENSOCUT00000022899
Sequence length 1316
Comment pep:known_by_projection chromosome:OryCun2.0:X:105686298:105702143:-1 gene:ENSOCUG00000009769 transcript:ENSOCUT00000022899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLRTFSILLFCIRLSLGVPSLVMESQPELWIESNYPQAPWENITLWCRSPSRISSKFLL
LKDKTEMTWIRPSFKTFQVSFHIGALTESNTGLYRCCYWKETGWSKPSKVLELEAPGQLP
KPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNMT
PENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAYPGHIMAPGESLSLRCQG
PIYGMAFALMRLEDLEKSFYHKKSIRNEAYFFFRSLKSHDAGHYLCFYYDGSYRGSLLSD
ILEIWVIDTFPKTWLLAQPSPVVQTGQNVSLQCRGPVVGVGLALYKKGEDKPLQFLDAAS
INDNKSFILNNVTLSDAGIYSCHYLLTWKTSIKMTSHNTVELVVVAWPSTVFKLGKAITL
QCRVAHPVLEFSLEWEERVTFQKFSVNGDFVISNVEGKGTGTYSCSYRIEAHPDIWSQRS
EPLKLMGPAGFLTWNYVLNEAIRLSLIMQLVALLVVVLWIRWKCRRLRIREAWLLGTAQG
VTMLFIVTALLCCGLCSGVLTEETEIIMPTPKPELWAETNFPLAPWKNLTLWCRSPSGST
KEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSEALELVG
TDILPKPVLSASPPVRGQELQIQCKGWLAGLGFALYKEGEQEPVQRLGAAGREAFFTIQR
MEDKDQGNYSCRTHTERRPFKWSEPSEPLQLVIKEMYPKPFFKTWRSPVVTPGARVTFNC
STPQQHMSFILYKDGSEVASSDRSWASPGASIAHFLILSVGIGDGGNYSCRYYDFAIWSE
PSDPVELVVTEFYPKPTLLAQPGPVVLPGKNVTLRCQGAFQGMRFALLQEGAQAPLQFQS
VSGNADFLLHTVDAEDSGNYSCIYYETTMSNRGSYLSMPLMIWVTDTFPKPSLFAEPSSV
VPMGQNVTLWCQGPVHGVGYILHKEGEATSVPLWGSTSNDGAFPITNMSGASIGRYSCCY
HPDWTSPIKLQPSNTLELIVTGLLPKPNLLAQPGPMVAPGENMTLQCQGELPDSTFVLLK
EGTQEPLEQQRPSGYRADFWMPVVRGEDSGIYSCVYYLDSAPFAASNHSDSLQIWVTDKP
PKPSLSAWPSMVFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDGDFVINNVEGKG
IGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPAAQECTVGNIVRSSLIVVVVVALGVVLA
IEWKKWPRLRTRGSETDGRDQTIVLEECNQEGEPGTITNSPSSPSQEISVELPVPL
Download sequence
Identical sequences G1U5K9
ENSOCUP00000024691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]