SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024850 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024850
Domain Number 1 Region: 445-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 333-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000344
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 491-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000286
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024850   Gene: ENSOCUG00000008958   Transcript: ENSOCUT00000008963
Sequence length 696
Comment pep:known_by_projection scaffold:OryCun2.0:GL018878:477937:490753:1 gene:ENSOCUG00000008958 transcript:ENSOCUT00000008963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLGPVSFKDVAVGFTQEEWRQLEPAQRRTYREVMLENYSHLVAVGCHFIKPDVITKL
ERGEEPWIEGGFLPQGCAGDEVWQAAGLIETVQEGEDQCSRPSVFTSSRALAGDGGRVPG
KTAEAEVQPVSSRSVASDCDACDRSLTCISEFISSDGSYARMKPDECSGCGKSVLHIKQE
RTPSGGESCDFNQNGEGCTLNEESICQKVRVLEKPFEYTESQKAFQKDPAFVNHVAERPY
SWGEPEMAFLQIPDLSVHQSAHLEMKPYECRECGKSFCKKSKFVIHQRTHTGEKPYKCNQ
CGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHLRTHSGEKPYECSYCGKA
FCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRK
STLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNDCGKTFYLNSALM
RHQRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGVKPYECSECGKTFYQNSALCRHRR
IHRGEKPYECYVCGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHTG
EKAYECYECGKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPY
ECTECGKKFYHKSAFNSHQRIHRRANVNVIDVARLL
Download sequence
Identical sequences G1U614
ENSOCUP00000024850 XP_017194595.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]