SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025665 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025665
Domain Number 1 Region: 31-113
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.67e-30
Family Hormone receptor domain 0.00000568
Further Details:      
 
Domain Number 2 Region: 120-378
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000137
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025665   Gene: ENSOCUG00000024444   Transcript: ENSOCUT00000021258
Sequence length 411
Comment pep:known_by_projection chromosome:OryCun2.0:10:14985084:15008460:-1 gene:ENSOCUG00000024444 transcript:ENSOCUT00000021258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAALLHSLLEANCSLALAEELLLDGWGQPLDPEGPDSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWALRINYSQCEPIFDDKQRKYDLHYRIALVVN
YLGHCVSMAALVAAFLLFLALRSIRCLRNVIHWNLITTFIRRNVAWFLLQLIDHEVHESN
EVWCRCITATFNYFVVTNFFWMFVEGCYLHTAIAMTYSTERLRKWLFLFIGWCIPCPIII
AWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETMQYRKAVKATLVLLPLLGITYMLFFINPGEDDLAQIVFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSALRKRWHRWQDHHSLRVPVARGMSIPTSPTRISFHSIKHTAAV
Download sequence
Identical sequences G1U8A0
ENSOCUP00000025665 XP_008259827.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]