SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025763 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025763
Domain Number 1 Region: 377-555
Classification Level Classification E-value
Superfamily SPOC domain-like 7.85e-49
Family SPOC domain 0.00034
Further Details:      
 
Domain Number 2 Region: 9-165
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.88e-31
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025763   Gene: ENSOCUG00000010322   Transcript: ENSOCUT00000010321
Sequence length 557
Comment pep:known_by_projection chromosome:OryCun2.0:9:18626303:18628000:1 gene:ENSOCUG00000010322 transcript:ENSOCUT00000010321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTI
DHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLP
VHYELLTDGYTRHRNLDADLRVRDRTPPHLLYSDRDRAFLEGDWTSPGKGPDRRNSLEGY
SRSVRSRSGERWGADGDRGLAKPWEERRKRRSLSSDRGRTAHSPYEERSRTKGGGQPSER
GSDRTPERSRKENHSSDGSREASGNSLSNSRHGAEEREAPDPSHGKKTRDGERNHRTSEA
EPKPPEEPKQEPKKLKSLSEYAQTLQLGWNGLLVLKNSCFPTSMHVLEGDQGVISGLLKD
HTSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQAAPTGPGTEGVPTVE
PGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCAFSQQYLQSALRTL
GKLEEEHMVIVIVRDTA
Download sequence
Identical sequences G1U8J6
ENSOCUP00000025763 ENSOCUP00000025763 9986.ENSOCUP00000025763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]