SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026203 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026203
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 331-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 666-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 9 Region: 293-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-16
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 235-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000085
Family Classic zinc finger, C2H2 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026203   Gene: ENSOCUG00000029363   Transcript: ENSOCUT00000033154
Sequence length 741
Comment pep:novel scaffold:OryCun2.0:GL019370:34834:41036:1 gene:ENSOCUG00000029363 transcript:ENSOCUT00000033154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAFEDVAVYFTWEEWQKMNNAQKILYRDVMLETYSSLFSLGHCITKPDLIFKLEQGAEP
WMVDECLNESLPVGMKRDDLIRINQESQDNNLNQDFMKNKKTSALKRVELRKTLSLNSSH
IPTLIIQKGSYSGLKPEECNKCHTVYPPSGPDQPQAGEKFDNTKIPGKPLQFCEPLGQHD
KIHIMEQPFGPTGQAKVFTRKMFCKSERVHMAENCNKSTVTFGKATQIEKAIYGNSSLNM
HQQTHTRKKFYKYIMYVEPVIHQSHLTINQRLNTREKLYTCKPCGKSLSFNSPSECNDCE
KAFGQKSVLRKRQQIHTGEKPHECSDCGKGFGRKSSLINHQRIHTGEKLYKCLHCGKGFL
WKSDLIKHQRMHTGEKPHECNDCGKAFGRKSHLIVHQQIHTGEKPHKCNDCGKAFGRKSC
LKIHQRIHTGEKPHECNDCGKAFGRKADLIIHQRIHTGEKPYKCNDCGKAFGQKSVLILH
QRIHTGEKPYKCNDCGKAFGQKSDLIVHQQNHTGEKPHKCNDCGKAFGRKLCLKIHQRIH
TGQKPHECNDCGKAFGQKSHLIVHQRIHTGEKPHKCNDCGKAFGQKSDLKIHQRIHTGEK
PHECNDCGKAFGQKSSLIVHQRIHTGEKPHKCNDCGKAFGRKSDLRKHQQIHTGQKPHKC
NDCGKAFGRKSDLRKHQQIHTGQKPHKCNDCGKTFGRKSNLIVHQRIHTGEKSHECNNWK
SLWTKVTAHRTPENSHRGETS
Download sequence
Identical sequences U3KLU5
ENSOCUP00000026203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]