SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026693 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026693
Domain Number 1 Region: 796-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 656-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 740-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.96e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 908-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 853-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 177-237
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-22
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 9 Region: 954-1006
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 11 Region: 703-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 438-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000867
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026693   Gene: ENSOCUG00000029290   Transcript: ENSOCUT00000033646
Sequence length 1009
Comment pep:novel scaffold:OryCun2.0:GL018880:360376:387392:-1 gene:ENSOCUG00000029290 transcript:ENSOCUT00000033646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRMRVLLQAALSWERRKFAYSSVGSERPQCCFSHPRRLSCLASATQAIFEQPLLLCVC
VWRPWVPRAADFPCPPLSALLHGRVGSERQGCCFSHARRLSRSASATQTVFKQPLLCASA
SGARGSHVPRTFPVPWSPLCSKAVQHRRKLEKFTFSSRSALAGSWKLELALEIKLMQSEV
MIAFEDLAVYFTWEEWQNMNKAQKILYRDVMLEIYSSLFSLGHCITKPDLIFKLEQGAEP
WMVEECLNQSLPVAMKSDDVIRTNQEFQDENLNHDVTTNNRSSTPKIVEISSSNHISKLI
IKHENYSAMKPEECNVCHNVYPHSGPDELQAGEKLDAVMVPGNSLKCCEPLNEYHNMQTV
TQSFEHSGYGKDFKREKIFFRFEMVHMGESYDGSTFTVGNTTQIEKTFHNDTNLSMHQQI
TTGEKFYEDIGYVEPLVYQSDLAINQIPDTGKKSYSCILCGKSFSYKSCHSIHHSIHIQE
NHHVCNECREITYQKSNLIRQHTREKSHEFNECGTAIFQKSYLIKHQRIHTGEKPYECND
CGKTFDYKSQLIIHQRIHTGEKPHECNDCGKAFGQKSDLIKHQRIHTGEKPHECSDCGKA
FGKKSNLVMHQRIHTGEKPYECSCCGKAFLCKSHLIKHQRTHTGEKPYQCSDCGKAFGSK
SNLLMHHRIHTGEKPYECNDCGKAFGQKSDLIKHQRIHIGEKPYECNNCGKAFAHNSDLM
KHQRIHAGVKPFECSDCGKAFGQKSDLIKHQRIHSGEKPHECNYCGKAFGYKSNLIMHER
IHTGEKPYGCNGCGKAFMRKSHLIKHQRIHTGEKPYECNDCGKAFGDKSNLLMHQRIHTG
EKPYECNDCGKGFGQKSQLLMHHRIHTGEKPHECNDCGKAFGYKSNLVMHQRIHTGEKPH
ECNDCGKAFGYKSNLVMHQRIHTGEKPYECNGCGKAFLCKSHLIKHHRIHTGEKPHVCSD
CGKAFGYKSNLVMHQKIHTGDKPHECNDCGKAFANKSRLIMHQRIHTRE
Download sequence
Identical sequences U3KN84
ENSOCUP00000026693 XP_017194602.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]