SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026892 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026892
Domain Number 1 Region: 563-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 619-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 661-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 314-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 271-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000228
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 10 Region: 526-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000123
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026892
Domain Number - Region: 223-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0518
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026892   Gene: ENSOCUG00000029686   Transcript: ENSOCUT00000033844
Sequence length 727
Comment pep:known scaffold:OryCun2.0:GL018740:613148:617626:-1 gene:ENSOCUG00000029686 transcript:ENSOCUT00000033844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITFEDLAVYFTWEEWQNMNKTQKTLYRDVMLEIYSSLLSLGYCMTKPDLIFKLEQGAEP
WIVEECLSQSLPVAMKWDYLTETHQESEDTNLIQDGMKYNKTSNLKRIVLRKTLNLSSSH
IPKLIIKKGAYSGMNAEECNVFQDVYPPSRPGDKFDATKVPGTSVQCYDPVSQHCKIQTV
KQSFEHTGQGKTFNRKKILCTFERVHKRDTSNKSTVTVGKAIQIEKAFHKNSKLSKHQQT
HTREKLSEYIKPVEHVINQSHLTINQRPQIGKKPYACTLCGNSFSYNSCHAIDHCTHIQE
NPHLCNESGETTYQKSYLMRHQKIHRQRKHHECNECQKIFFQKSNLITHQKIHTRKRPHE
CNDCGKAFCYKSQLKIHQRTHTGEKRHECNDCGKAFGFKSHLIQHQRTHTGEKPHECSNC
GKAFGSKSHLIQHQRTHTREKPHECNDCGKAFGSKPQLIRHQRIHTGEKPYVCNHCGKAF
CYKSQLIIHQGTHTGEKPHECNDCGKAFGFKSHLIIHQRIHTGEKPHECSDCGKAFVCKS
GLIRHQRTHTGEKCHECNDCGKAFSQKSNLITHQKIHTGEKHHECNYCGKAFSQKSYLIT
HQRIHTGEKPYECNDCGKTFSHRSHLQTHQRIHTGEKPYECIDCGKAFSQKSQLITHQRI
HTGEKRHECNNCGKAFYQKAQLITHQRIHTGEKRHECNDCGKAFGQKSHLLLHQRIHREK
KPNYFND
Download sequence
Identical sequences U3KNT3
XP_008273628.1.1745 XP_008273633.1.1745 ENSOCUP00000026892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]