SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026919 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026919
Domain Number 1 Region: 437-535
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.24e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000204
Further Details:      
 
Domain Number 2 Region: 579-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000087
Further Details:      
 
Domain Number 4 Region: 1050-1125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.28e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000914
Further Details:      
 
Domain Number 5 Region: 146-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000012
Further Details:      
 
Domain Number 6 Region: 345-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000367
Further Details:      
 
Domain Number 7 Region: 972-1048
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000868
Further Details:      
 
Domain Number 8 Region: 727-831
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 9 Region: 1120-1201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000679
Further Details:      
 
Domain Number 10 Region: 866-918,948-971
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 11 Region: 290-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 12 Region: 218-294
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026919
Domain Number - Region: 99-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0486
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026919   Gene: ENSOCUG00000012667   Transcript: ENSOCUT00000033871
Sequence length 1268
Comment pep:known_by_projection scaffold:OryCun2.0:GL018993:65271:99407:-1 gene:ENSOCUG00000012667 transcript:ENSOCUT00000033871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLDGAQEP
AGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVTIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPSVNRSEIVFTGEKEQLAQAVARIRKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSVSETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVA
QEQIEGMVKDLVNRMDYVEISIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKARKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKE
DAVREAQKELEALIESLDNVVEEHMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVTLKGAKDCVEAAKRRIQEIIEDLEAQVTLECAIPQKFHRAVMGPKGSRIQQIT
RDYNVQIKFPDREENPVHSMEPAVQENGEESGEGRDTREAEPGSPRRCDIITISGRKEKC
EAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAI
TGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSITVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGTQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHA
RIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
VVDSEALQVYMKPPAHEESKAPSKGFVVRDAPWTSASSEKAPDMSSSEEFPSFGAQVAPK
TLPWGPKR
Download sequence
Identical sequences G1T3V0
XP_002723639.1.1745 XP_008250394.1.1745 XP_008250395.1.1745 XP_008250396.1.1745 XP_017195197.1.1745 9986.ENSOCUP00000010914 ENSOCUP00000010914 ENSOCUP00000026919 ENSOCUP00000010914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]