SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026942 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026942
Domain Number 1 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 327-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000681
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 263-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000776
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026942
Domain Number - Region: 231-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0349
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026942   Gene: ENSOCUG00000029177   Transcript: ENSOCUT00000033894
Sequence length 636
Comment pep:known scaffold:OryCun2.0:GL018740:1955618:1976390:1 gene:ENSOCUG00000029177 transcript:ENSOCUT00000033894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMSLVLMSFEDLAVDFTWEEWKFLTNAQKTLYRNVMLETYSNLLFLRHCITKPDLIFKL
EQGPEPWMVEEHLNQSLPVAPNDDLIGNNQESQDIKLNQNVITNNSTSTPKRIKLRKRLN
LSSSHIPKLIIKKVNRSGMKPEACNIFQNVHLISGPDVFQVVEGKSDAPNVPENSFQCSE
PLNQCHEMQTVQQPVELSGYRKGFISERVCMEENCNKSIAIVKNTTQIGKKASHKNSYLS
KYQQNHIREKPYESTEYEKTLIYKSDLLVNQRTYTGNKGYVCKPFGKSCSCKSCLTIHQR
THIRGKHYVCNESDLTSNHRNDISEKFYECVKAFCQKSYLITHQRIHAREKPYECDECGK
GFCWKSHLITHQRIHTGEKIYECIECRKAFCYKSALIRHQKIHTGEKPYKCDECEKGFCR
KSHLITHQRIHTGEKIYECIECGKAFCYKSVLFRHQKVHTGEKPYKCNECGKAFCDKSIF
KSCQRMHKGEKRYKCNECGKTFCRKSVLITHQRIHTGEKPFKCNECEKAFCDKSFLKTHL
RIHTGEKPYKCNECGKAFCQKSYFRTHQRIHTGEKPYKCKECGRAFARKSYFIIHQRIHT
GEKPYECNDCGRAFCQRSHLIRHQRIHTRKKSYKYC
Download sequence
Identical sequences U3KNY2
ENSOCUP00000026942 XP_008273649.2.1745 XP_017193085.1.1745 XP_017193086.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]