SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026972 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026972
Domain Number 1 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 25-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 6 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 333-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000423
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 480-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000671
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 564-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000222
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 288-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000737
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026972   Gene: ENSOCUG00000029239   Transcript: ENSOCUT00000033924
Sequence length 702
Comment pep:novel chromosome:OryCun2.0:18:3324362:3436235:-1 gene:ENSOCUG00000029239 transcript:ENSOCUT00000033924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKRGNGPATVLMLIQRHLMYSVFLKVLVSFEDLAVDFTQEEWQDLDNAQKTLYKDVML
ETYSSLLSLGHCIIKPDLIYKLEQGAEPWIVEKPLNQSLPVVQKMSDLIESNQERQDINL
GQIANRKSTSTQKRLKLRKTVNLSSSHIPKLITKKRNCSGRKTETSSAFQNMHFTSGLDE
MQVQEKSDGCNTPRTALSHWEQLRQHHKIQTVQKPFEQSGQWKGFSRRRLLFACEKAYGG
KICSNLTAIVGKATQIENKAIHKNSNVTEQQQSHMEEKPYESFEEMLTYKSDLKISQRPH
TGRKPYEYKCHQESFNCKLCLTIHHRTQVWEKSCEYNKCGKVSYQKSDLVSQKLGLIKHQ
KIHTREKTYECDECGKAFHLKSHLIRHQRIHTGRKPYECDECGKAFRQQPHLITHQRIHT
GGKPYECDECGKAFHQTSNLITHQRIHTGWKPYKCDECGKAFRQKSSLITHQRIHTGGKP
YECDECGEAFRQKSHLITHQRMHTGGKRYECNDCEKTFSRNSSLIIHQRIHTGEKPYECN
ECEKAFHRKSDLITHQRIHTGEKPYECNKCGKTFCHKSYFIKHQRIHIGDKPYECNKCGK
AFHQKSDLIKHQRIHTGEKPYECVKCGKAFHRKSDLVTHHRIHTGEKPYECNTCGKAFCH
KSYLSTHQRIHTGEKPYKCNECGKTFSQKSSLNRHHRIHTYH
Download sequence
Identical sequences U3KP12
ENSOCUP00000026972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]