SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027007 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027007
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.49e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-24
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 170-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027007   Gene: ENSOCUG00000029684   Transcript: ENSOCUT00000033958
Sequence length 532
Comment pep:known_by_projection scaffold:OryCun2.0:GL018804:693331:712875:-1 gene:ENSOCUG00000029684 transcript:ENSOCUT00000033958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGRAKRWKGLLSFKDISMEFTWEEWQLLDSTQKYLYRDVILENYSNLVSVGYHGTKPDL
IFKLEQGEEPWIIAKISSQSCPEGWEEWYQKNQDELESVERSFACNVFGKLHLSKTCVFS
KQRLHKYSTHGKSLTQNSDSSISYVRKNLDKCHGYEESYFLRHKRGHGIEKNCVCSECGK
AFRCKSQLIVHLRIHTGERPYECTKCERAFSAKSNLNAHQRVHTGEKPYSCGECGKVFSF
RSQLIVHQEVHTGGKPFGCSECGKAYSWKSQLTLHQRSHTGVKPYECSECGKAFSLKSPF
VVHQRTHTGVKPHKCDECGKAFRSKSYLLVHIRMHTGEKPYQCSECGKAFNMKTQLIVHQ
GVHTGNNPYQCTECGKAFGRKEQLSAHLRAHAGEKPYGCGECGKAFSSKSYLVIHRRTHT
GERPYECNLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKP
FKCTECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKAFCWNSGLRIHRKTHK
Download sequence
Identical sequences U3KP47
XP_017193925.1.1745 ENSOCUP00000027007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]