SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027114 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027114
Domain Number 1 Region: 354-518
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-41
Family Dual specificity phosphatase-like 0.0000188
Further Details:      
 
Domain Number 2 Region: 529-662
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.56e-37
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 3 Region: 212-346
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000102
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027114   Gene: ENSOCUG00000029469   Transcript: ENSOCUT00000034065
Sequence length 663
Comment pep:novel scaffold:OryCun2.0:AAGW02077833:31031:119793:1 gene:ENSOCUG00000029469 transcript:ENSOCUT00000034065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRFKKNRQYRWFSKKKNTDMDDNPLTDILVVPNQNVNNSPALNEAVSTHGGVENESPAL
NEAVSTHGGVENESPNQGKLNSVTMEDPNEWDDNPLTDILVVPNQNVNNSSQPKESTSIT
FVESINDKPNTEELTYENYEEAPSTMTSIYEYGSLHVDGATSEVTAQSDLKTSPSEHISV
STPLSQSTVISVDEDVDETSKMKNTTRLIVSAFAFRVFGILLIFVDIFLIMSDVIFNDNK
IVFECHSISLAIALFFFFDVLLRVYVEGRKTYFTDLFNILDAVIIAITLLIDTIYFFFDL
RFLKDVPRVAVLLRPLRLIILVRVFHLAYQNRQLQKLTRRLVSENKRRYRRDGFDLDLTY
ITDRIIAMSFPSSGKQSFYRNPIKEVVRFLDTKHRNHYRVYNLCSERAYNPEHFHNRVQR
IMIDDHNVPTLSEMVVFSKEVNMWLAQDKKNVVVIHCKGGKGRTGTMVCACLIGNQIFGT
AKESLAYFASRRTDHTISSKFQGIETPSQSRYVGYFENVKNLCNWTLPPKKILTPYKIII
YSIHNVGKGDGSDLKIQITTKQQTVFSCSSSKNCKIFHDVETDKVIIELLNCPILYDDVK
VRFLSRNLPKYYDNCAFFFWFNTAFIQNNRLYLRRNELDNPHKRKAWKIYSSCFSVEMYF
NQT
Download sequence
Identical sequences U3KPF4
ENSOCUP00000027114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]