SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027160 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027160
Domain Number 1 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 297-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 2-39
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000183
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 
Domain Number 8 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000113
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027160   Gene: ENSOCUG00000029241   Transcript: ENSOCUT00000034111
Sequence length 633
Comment pep:novel scaffold:OryCun2.0:GL018812:539453:544766:-1 gene:ENSOCUG00000029241 transcript:ENSOCUT00000034111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHAQKILYREVMLEIYSSLLSLGFCVTKPELIFKLEQGGEPWILEEDLNQSLPVTMRRD
CLIMNNQENKGKNLNQDVIKYNRTSTPKCVELSAFLNSSSSHMTKLKGNYSGMKPVECNI
FKNVHLPSGADELEAGGKFDAIKVPGISLQCWDHLSQHHKILSVTQTLEHNEEKAFNSME
KFCTSEKVHMLETCNKSSVTVGKATQIEKKFHKYSNLSKHQHTYEREKLGEPIRSVASGT
YQSHFAINQRQQIGTKSYACKLYGKSLSCKSCHSIHHSAHIQENLCVSNECVKTTYQKSD
LIRHQKIHRQNKPYECNECGKAFLQKSDLVRHQRIHTGEKHECNDCGKAFSQKTHLMAHQ
RIHRREQPHECNNCGKTFGYKSHLMAHQRIHRREKPHECNDCGKTFGYKSHLVAHKRIHT
GEKPHECTDCGKAYSQKSHLIEHQRIHTGEKPYKCNDCGKAFSCKSYLIAHQRIHTGEKP
YECKDCGKAFSQRSYLITHKRVHTRERPHECNDCGKAFGHKSHLIAHQRIHTGEKPHECT
DCGKAFAQKSHLIGHKRVHTGEKPHECNHCGKAFGYKSHLITHQRIHTGEKPHECNDCGK
AFAQKSHLIIHQRIHTREKPPECNDCGKAFGHK
Download sequence
Identical sequences U3KPK0
ENSOCUP00000027160 XP_017194026.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]