SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000060 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000060
Domain Number 1 Region: 599-788
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-48
Family DBL homology domain (DH-domain) 0.000000135
Further Details:      
 
Domain Number 2 Region: 792-927
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-39
Family Pleckstrin-homology domain (PH domain) 0.00000102
Further Details:      
 
Domain Number 3 Region: 282-421
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 40-196
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 5 Region: 382-520
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000781
Family Spectrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000060   Gene: ENSORLG00000000049   Transcript: ENSORLT00000000060
Sequence length 939
Comment pep:known_by_projection chromosome:MEDAKA1:4:109210:135657:-1 gene:ENSORLG00000000049 transcript:ENSORLT00000000060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVGLCTYLCLHQLWLCMCCVSLPLDEIMQQDIRPLLAVDIIEQLHLQFALLSGGRGKDG
APIIIFPEYSGFSEVPEEDFLNVVTYLTSIPSLDAASIGFIIIMDRRKDKWSSVRGCLSR
IAGAFPGHLQLVLVLRPSRFFHRTVTDIGIKMHKDDFKMKIVMLNSLSDLHGYVDKSQLT
RELGGSLDYNHSQWMHHRTAIENFAMTVKSTAQMLQRFGNELAETDLPQDVQSTKDLLAA
HTDRHNHLKDELKLALRQGSTLSGCIKEQAAKSENHELNPDETENQTTVERLMAQLDETD
NAFEQFWSKHHLKLEQCLQLRHFEKDFREVKVTLDGLMNSVNTLADTADCAARVELLLKD
LKALEDKARPSLEKAQLQALHGDQLIQSSHYAVDSIRPKCVELRRVCDDFSNEVQKKHDV
LSKSLQIHRGIDKVNQWCDSGIYLLASQAVDKCQSQEGAESALTDIENFLESAEKNQLTE
LKNLHNQFEMVLSEDLKGSVQMVLKRLEDVQEMFEKRHVSLKRLSAKQTRPIQPVAPRPD
SSPKRPSLRNPPRATVRRKSEAHETSNRNIRLSMFLLQIEVMHEESQGGSAHVVAPAESE
ESLSSRRRHIMTELIETERIYVEELQSILEGYYVELNNSEFSHLIPPSLENKRDVLFGNL
PEIYDFHNKTFLMELENCVEKPELVGSCFLNRKEELQVYEKYCQNKPRSEVLWRQCGDSL
FFQECQKKLDHKLSLDAYLLKPVQRITKYQLMLKEMLKCSKDEGMVELEEALATVIDIIK
SVNDSMHQIAITGFDGNLSELGKLLMQGSFNVWTDHKKVHSKVKDLARFKPMQRHLFLYN
KMLLFCKKREDATEGYEKTPSYSFKHSLKMSAVGITENVKGDSKKFEVWYNGREEVYIIQ
APSMEVKNIWVSEIRKVLTGQLEACRGEIGENLSLRQSQ
Download sequence
Identical sequences H2L2V8
ENSORLP00000000060 8090.ENSORLP00000000060 ENSORLP00000000060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]