SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000110 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000110
Domain Number 1 Region: 36-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000046
Family VWC domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000110   Gene: ENSORLG00000000079   Transcript: ENSORLT00000000110
Sequence length 1497
Comment pep:known_by_projection chromosome:MEDAKA1:2:5048904:5063825:1 gene:ENSORLG00000000079 transcript:ENSORLT00000000110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSATVTLQPLMQLTTLQDICVAYRPRQSADERGEESCTVDGEVFSHNDIWKPSPCRVCI
CDHGVAICDEIQCEGVMGCEKVVTPEGECCPVCENFASASRRIGTINGQKGEPGDIPYVE
GNPGSPGPQGPPGSQGHPGPRGFKGRRGFQGPPGFDGEPGVPGNPGRPGSPGEHVPPGGN
VAMQMVSGFSEKSGPIGMLTDTRGEAGPRGPPGEPGSSGPTGGQGIPGEAGEPGPMGEPG
HRGPDGAPGKPGRDGEPGPDGAPGEPGNPGSQGPRGFPGLPGNRGLKGPKGNAGPQGPKG
ELGVVGLKGKSGAPGTMGAPGPQGPPGLQGERGRIGPTGHVGKQGTPGDVGKPGPMGPIG
IPGLPGYPGNPGMKGEPGPAGVRGILGPQGPRGDAGRVGPSGPTGQRGAAGADGSPGPRG
SSGIAGVQGPPGLVGAAGLPGPQGSTGAPGAKGQLGDGGVPGLKGEPGMKGERGEHGTPG
PIGLMGEDGKRGPRGDAGSIGPPGPAGETGAPGNRGFPGSDGLPGQKKQGAPGERGLPGV
GGAKGLSGDPGRNGEPGLTGARGLAGPIGAQGAEGGPGQMGLAGEDGKPGPAGAAGNRGS
AGTMGLPGPKGFAGDAGKAGEAGSPGPPGQRGPNGKDGEEGAAGPPGPAGLAGKRGEQGP
QGISGFQGLPGPPGPPGESGKPGDQGLAGEAGAVGATGPRGERGPSGERGETGPNGLQGP
KGSPGGPGPDGPKGNPGPKGADGEPGAPGLQGMSGERGIPGSSGPKGDAGSIGEKGPEGK
AGADGPRGLPGSVGPIGPGGPNGDKGETGPPGPTGRRGTRGVPGSTGEPGPIGPAGFPGP
PGPDGQPGVKGETGEPGLKGEAGAPGPQGMAGKPGTQGPVGVTGLKGGRGTQGQAGSPGF
PGLPGGVGPPGALGAAGAAGPIGEPGKRGPSGVRGENGAPGRKGESGTPGLPGSPGEKAE
SGEDGPPGPDGPPGPPGATGQRGVVGQPGPRGEKGLVGLPGPAGPPGKPGTPGASGGKGP
AGGIGLPGASGPRGDAGSEGIAGAEGPPGKDGLVGERGQRGEPGPEGLPGGPGSPGNEGP
VGTTGGPGSRGEKGPRGPPGSQGQPGVRGKVGPQGPQGEKGGAGEQGERGQKGHRGFTGL
QGLPGITGATGDTGEKGIVGPAGLRGPPGVTGPPGNEGIIGQPGPMGPPGSRGSSGDLGE
QGPSGEPGPPGPPGPPGPPSANVNDLFSHSVDYEENLVDPESDGDEALPNKNLAVLNADM
GIKVTLKALNGNLQVMRSPDGSKENPAKTCRDIKQCYPEKKSDTGEYWLDPNQGSTKDAI
KVFCNMESDETCISASQAVIPGKAWWTKSSPSPNKPVWFGADINGGTKFLYGNKEERQNA
VTVQLKLLQLLSRESHQNVTYRCKNSVAVKDEKSSNFKKALVLKGYNGQEIKAHGNSRLR
YTVIEDGCSKSNGQWAKTVIEYRTQTSTRLPIVDLAPMDIGQADQEFGLDIGPVCFL
Download sequence
Identical sequences H2L305
ENSORLP00000000110 8090.ENSORLP00000000110 ENSORLP00000000110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]