SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000296 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000296
Domain Number 1 Region: 34-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000113
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 2 Region: 238-282
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 3 Region: 103-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family Fibronectin type I module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000296   Gene: ENSORLG00000000240   Transcript: ENSORLT00000000296
Sequence length 392
Comment pep:known_by_projection chromosome:MEDAKA1:1:1783657:1788952:1 gene:ENSORLG00000000240 transcript:ENSORLT00000000296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSISPVEFTMKLLLLIHLTAVAIITQVTSSCPAVCECPAEPPLCPPGVSTVPDGCACCRV
CAAQLNQDCSPTRPCDHHKGLECNHGNSVTMAWGICRAKSEGRTCEFNGRIYQSGESFRA
GCKHHCTCMDGAVGCSPLCSNNLPPPSPSCPYPRLVRSPGQCCFSVDCRKDAWFLPPGHK
DSSQEPKLSLRPAGRRSDEEQILTNQLPDSSPSKNLPGRSEVTVMSPPSAWKPPQEKTCL
VRWTDWSQCSRSCGMGVSSRITNDNARCEPETETRICTVRPCGGLTVPAKXKGRSCSPTQ
KAPHPVYLSYGECVSVRPYRPNYCGVCTDGRCCSPRRTRTVPVTFLCPDGERLRRSAMFI
QSCQCSRDCGHLNEVAPPPQRWMFGDARSSSD
Download sequence
Identical sequences H2L3H4
ENSORLP00000000296 ENSORLP00000000296 8090.ENSORLP00000000296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]