SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000300 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000300
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000895
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 2 Region: 192-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000300
Domain Number - Region: 98-161
Classification Level Classification E-value
Superfamily FnI-like domain 0.0012
Family Fibronectin type I module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000300   Gene: ENSORLG00000000240   Transcript: ENSORLT00000000300
Sequence length 341
Comment pep:known_by_projection chromosome:MEDAKA1:1:1783672:1788937:1 gene:ENSORLG00000000240 transcript:ENSORLT00000000300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEFTMKLLLLIHLTAVAIITQVTSSCPAVCECPAEPPLCPPGVSTVPDGCACCRVCAAQL
NQDCSPTRPCDHHKGLECNHGNSVTMAWGICRAKSEGRTCEFNGRIYQSGESFRAGCKHH
CTCMDGAVGCSPLCSNNLPPPSPSCPYPRLVRSPGQCCFSVDCRKDAWFLPPGHKVTVMS
PPSAWKPPQEKTCLVRWTDWSQCSRSCGMGVSSRITNDNARCEPETETRICTVRPCGGLT
VPAKKGRSCSPTQKAPHPVYLSYGECVSVRPYRPNYCGVCTDGRCCSPRRTRTVPVTFLC
PDGERLRRSAMFIQSCQCSRDCGHLNEVAPPPQRWMFGDAR
Download sequence
Identical sequences H2L3H8
ENSORLP00000000300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]