SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000338 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000338
Domain Number 1 Region: 284-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000955
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000338   Gene: ENSORLG00000000275   Transcript: ENSORLT00000000338
Sequence length 338
Comment pep:known_by_projection chromosome:MEDAKA1:10:1061032:1073066:1 gene:ENSORLG00000000275 transcript:ENSORLT00000000338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METAMTALFLSGALCHLLVLMIGLSQGVHSVPVPTDLPMCTASEPAQYSLTFSGKWTRAA
FPKQYPVYRPPAQWSNLIGVTHSLDYHMWQRNEFASNGVREFAEKSEAWTLMKEVETAGE
RIQSVYGILSAPAVVGGTGQMDTEFEVFARHSLMSFMVRIIPSPDWFVGVDSINLCNGDK
WKESVTLELFPYDAGTDSGFTFSSPNFETIPQDRITQITSSYPSHPANSFFYPRLKHLPP
IAKVKLTKIKKTNQIISLPMEPTQSNLLPTGNEIEETLINTPLDCEVSVWSPWGLCKGKC
GESGVQHRTRYVIMHPANNGVACPLLEEERKCIPDNCL
Download sequence
Identical sequences H2L3L4
ENSORLP00000000338 XP_004073065.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]