SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000355 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000355
Domain Number 1 Region: 708-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000183
Family Somatomedin B domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000355
Domain Number - Region: 56-128
Classification Level Classification E-value
Superfamily E set domains 0.00546
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000355   Gene: ENSORLG00000000288   Transcript: ENSORLT00000000355
Sequence length 767
Comment pep:known_by_projection chromosome:MEDAKA1:9:450153:459058:1 gene:ENSORLG00000000288 transcript:ENSORLT00000000355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLFVWGLWFISSTETAGPTCRGRCGTVLQECSCRASCVSLESCCADFQRSCFQVSPY
SSSMLGGRLLRIQDLDLNPGGNLFCRFKGEMQRRGFLEGKLGAFCVSPLLFETGWIPFDV
STDGVDFNRSGEFLSVHPSRADPALQVTLVDPERWQNYGVTGEAGPLRTTWNRSLIQTEK
VNVELWGYREVNRTSGAVTSSPQAELRYLYSLGRNVPNSGDFGFDPQPRAEFSSWELGNI
RITASFQSEGERDVEGLWSPGHVLAWHLEQAFRDDPAGWAWDRCLRWDRHEKTLPDVLDE
LEDCPCTLAQARADTGRFHTDYSCNLDSGSACTYHPGSVHCVRGIRAGRPASGSGQQCCY
DGSGSLLLTGDSAGGSTPDRAHDWGSPPYQKPPRVPGYSHWLYDVVSFYHCCLWSDGCHV
YFNHRPSSGCSRYQPPTAGLVFGNLHFITFDGFSYTFSGKGEYQLLSSGELSLQARTERA
KLPNGSLADATQLSAVAMRENSSDVLEVRLAGGRLQVLRNQKVLPFSENKWMDLRGAFVF
GPAPNHVSVMFSSGVGVEVHLNGGALAATVLLPAEFSNHSQGLLALKAADQSRGPPQFGR
GAYMEDMFVIGASWNISKTSSLFTYDSDDLLDSYYFPPSHDSTFVPAFTPPETPGDPLVA
DMRAACVGEGAEFCEHDTLVTRSLEKGNASLGAYRGHRTLRRALEPVVSCGFLPAPTNGK
KNGTRYLQGDTVRFSCDDGFLLFGSEERRCLDDGSWSGERTHCVRGR
Download sequence
Identical sequences H2L3N0
ENSORLP00000000355 ENSORLP00000000355 8090.ENSORLP00000000355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]