SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000366 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000366
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-28
Family Kringle modules 0.00071
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000366   Gene: ENSORLG00000000299   Transcript: ENSORLT00000000366
Sequence length 465
Comment pep:known_by_projection chromosome:MEDAKA1:9:509864:539669:1 gene:ENSORLG00000000299 transcript:ENSORLT00000000366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMFDVYSIELMFCILFKHLLRLCWDSFLLCALLSECYTANGEDYRGLQNQTSLQAGKPCL
FWNETFQHPYNTLKYPNGEGGLGSHNYCRNPDGDVQPWCYIADHEDGIYWKYCDIPTCQM
PGNLGCFKDSGNPPTLSGANEISNKLTIQNCISFCRKQRYRLAGMESGYACFCGNEVELQ
DHGESAGMDCNHVCFGDHTQPCGGDGWVIVFDTRVGACGGNYTSPSGVIYSPDFPDKYSA
SRVCYWTIQAPGSFAILFNFTFFDISDQADMVELLDGYTNQVMARFDWRSPPRELVNITG
DFVILYFYSDRTNQAQGFALLYQALRNQETGTIEGHDGVKGDVRSTAKPAPAGITERSNG
TSNGHSTQILFITSSPGKPEHNMPVWTIYALAALLILTVLAMVAKLLLHVSVKSPTIPTV
SGSDGCGPGPVSSEPWIILYRPSTISLFKKKLKNHHGDLSPLVGN
Download sequence
Identical sequences H2L3P0
8090.ENSORLP00000000366 ENSORLP00000000366 ENSORLP00000000366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]