SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000863 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000863
Domain Number 1 Region: 262-351
Classification Level Classification E-value
Superfamily Immunoglobulin 7.74e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 94-153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000111
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 179-244
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000968
Family Pre-dockerin domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000863
Domain Number - Region: 446-499
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0143
Family Carboxypeptidase regulatory domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000863   Gene: ENSORLG00000000703   Transcript: ENSORLT00000000864
Sequence length 1135
Comment pep:known_by_projection chromosome:MEDAKA1:4:2285695:2296437:-1 gene:ENSORLG00000000703 transcript:ENSORLT00000000864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWTSWFNIDHPGGNGDYERLEAIRFYYRERVCSRPTAIEARTSDWLTAADTGEVVHSSLE
KGFWCINKEQPKGNICSNYHVRFQCPPGSPVDNMQSYWTEWSEWGPCSATVCSDVGIQVR
QRKCLSSQPMPLLFVPACQGHHSERRECSTPQCTAKCQLVCEEGHPSEDCSLCVCEDHVL
HGDVHSVTGVPVEGARVSLASHSKALHAQTNAKGQFVLAGVCSSTSSSIIIKKEKYVPTI
VSTSSNTTGLSRLKAVLRSAEKPYVVKHPEDKVRYEGGRVLLCCSATGSPAPSKYYWYHN
GTLLDRKIYKYEEDLMLQDLKFEHSGEYYCKTSNPAGSIKSSVAILSVIAKGTPACDSTP
EAHLIRLPLDCVQPGTQSKYYNAGRCPHNKCAGSLEFDMRCKDGAGFCCGVQSMESRVID
CGSYSLPIRAVTKCICQKCMQPTVIVRGRVVTADNNEPLRFGHIYIGKERVGTTGYQGGF
TLKIAQDTQRLVVNFVDPTETFLNTPKVFIFDKKSGSIYHDVKVMRKQKPIDINSRETNV
IDLGEIKGEDPIGQLVIPPNSFHKDTGEVYEGTVKASVTFIDPRNITTAAATPGDLNFVD
DEGDMLPLRTYGMFSVDFRDNSSNKVLGAGAVQVLLDTQHVKMQEHIPQMKLWSLNPDTG
VWEEESKFSYSTTTADGHGRSKREERTFLIGNMEIRERRLFNLDVPESRRCYVKVRAYMS
DKFLPTEQLEGVVITLINLEPKPGYSSNPRAWGRFDSVITGPNGACLPAFCDAMRPDAYT
AYVTAMLNGEELEAAPSTPKMNPNIIGVSKPFLDKLDYQRSDHTDSALKKTAFKINLAKP
NQNNLDETNGPIYPYQSMIACENAPIDANHFRFFRVEKDKYEYNVVPFEENDLTSWTGDY
LSWWPNPQEFRACFIKVRIHGQKEVMVRSRNHGGTHPETKDKLYGIRDIRSTRDMREANT
SAACVEFKCSGMLYDQSEVDRSLISVLPQGNCRRININNLLQEYLIKHPPFTQSNGSHSF
TMMAPVDPLGHNYGIYTVTDQNPRVAKEIAIGRCFDGTSDGFSREMKSDSGVALTFSCPE
RKINRQSLFQRLQTNPGQTLSQMARDMRDFQGEQRQRSAILSINLRITQIQPVVN
Download sequence
Identical sequences H2L507
ENSORLP00000000863 ENSORLP00000000863 8090.ENSORLP00000000863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]