SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000920 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000920
Domain Number 1 Region: 165-541
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.18e-90
Family Phosphonoacetate hydrolase 0.029
Further Details:      
 
Domain Number 2 Region: 639-880
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.41e-22
Family DNA/RNA non-specific endonuclease 0.013
Further Details:      
 
Domain Number 3 Region: 60-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000353
Family Somatomedin B domain 0.003
Further Details:      
 
Domain Number 4 Region: 108-145
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000968
Family Somatomedin B domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000920   Gene: ENSORLG00000000744   Transcript: ENSORLT00000000921
Sequence length 895
Comment pep:novel chromosome:MEDAKA1:11:1057078:1089736:-1 gene:ENSORLG00000000744 transcript:ENSORLT00000000921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDEKMTVSTDHHDKRISQNSDSFFVLCMMQICVLAASIVTLILGLGLGLGLELQSFPPGT
SCRDRCYQPFDDEIPGCRCDSNCAATGSCCFDFHDICTIPAQQWECTKIRCGEKRLTQSK
CHCSDDCLSAGDCCTNYKHICQGNVGEKEWVEGECEDLWPPSCPAGNSFKRQPLLLVSLD
GLRAEYMQTWNTVMPVLNKIRTCGTSASYMQPAFPSKTFPNHYTIVTGLYPESNGLIDNT
MYDPVFNATFSLSNSEKNNPDWYLGQPVWHTAKNQGLKSGTFFWPGSDVEINGSFPNIYK
PYDGDVPFEERVLTVLKWLQLPDNERPDFYTLYLEEPDKSGHSFGPVSGGIIISLQGVDK
IIGQLMNGLKQIGLDRCLNIVILADHGMEEISCDRKEAMQDLGVDTSLYVVTEGPFGRIR
AKNVDTTCFAFSTVDSAALVASMSCKKPDQKITPYLKAHLPKRFHYADSRRIEDVNVLVE
PKWLFERYLLFIFCFGGNHGYDNDADSMHALFLSYGPKFQFRTEVEPFSSIELYNLMCDV
LEITPSENNGTHGSMNHALRNPYHTPVHPVEQSAPGQCPLVSLVPEDDLGCSCSSLFKNR
PTRAEEGNTINSRLNLTAAQVSAAEKRHMLLGRPQMLQPDQSYCILHQEGFVSAYSHKVL
MPLWSSFTVEKPTDITPLPPVISDCLRADVRLTPSQSPRCDLYETAGSLTPAFLFPPNLN
VSADQQYDALLMSNVVPMYPRFKEIWDFFHNSLLKKYAFLYNEINVVTGPVFDYDYNGCY
DTPDQILESVPGTNISIPTHYFVLMTSCGDSTQTVSSCTGQLQTASFLLPHRADASESCK
SSEEASRWVEDHMWFHQARVRDVELITGLDFYQGSKRPVAELLKIKTRPTAAIHR
Download sequence
Identical sequences H2L555
ENSORLP00000000920 ENSORLP00000000920 8090.ENSORLP00000000920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]