SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000985 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000985
Domain Number 1 Region: 103-466
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.5e-91
Family Phosphonoacetate hydrolase 0.019
Further Details:      
 
Domain Number 2 Region: 568-826
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.59e-27
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 57-96
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000105
Family Somatomedin B domain 0.0038
Further Details:      
 
Domain Number 4 Region: 8-49
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000314
Family Somatomedin B domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000985   Gene: ENSORLG00000000802   Transcript: ENSORLT00000000986
Sequence length 836
Comment pep:known_by_projection chromosome:MEDAKA1:11:1095903:1109801:-1 gene:ENSORLG00000000802 transcript:ENSORLT00000000986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEWVSTSGSCKGRCFELKVTDPPGCRCDNLCKTYYSCCSDFDEHCLKTEGGFECRPDRCG
EERNENHACHCSEDCLERGDCCSNYKSVCQGETSWVEGDCEEIKSAECPAGFIRPPLIML
SLDGFRASYLKKGKSVIPNIHKLRTCGTSSPYIRPVYPSKTFPNLYTLATGLYPESHGIV
GNTMHDPVFNATFSLRTREKLNHRWWGGQPIWITAEKQGVKAGTFFWPWVIPFERRVLTI
LSWLHLPDDERPYVYAIHSEQPDTFGHRLGPLSSELDNPLREIDNIIGQMMNGLKQMNLH
RCVNVILVGDHGMEEAHCDRIEFLNSYPLKIEEIALIPGSLGRIRARDPKSSSYDPKVVV
ANLTCKMPTQHFKPYLKQHLPKRLHYANNRRIEDVHLLMEKKWQIARKTPEKPRTRCGFF
GDHGFDNKITSMRTIFIGHGPSFKFQKRVPEFENIELYNIMCDLLGLKPAPNNGTHGSLN
DMLKEPVFHPTMPEEVTPPSPASDSDGKGTNDLGCSCDHEVRYKQHLRDLSKTYFTKLSQ
NPVLLKFYGIFSHEAYTKYQYSVRNTTHLPFGRPAVMFSTEYSLLHHVEFISGYSRELAM
PLWTSYTLSRQDDMTAVPEVSPSVKCVQADPRVSPDHSQSCSGYSQNSHLTYGFLFPPVL
STSPASRYDASLITNTVPMYPAFKRIWTYLQETLVRRYAEENNSINVLSGPVFDHNYDGL
RDTVEQIKEFSVEGLPVPTHFYTVVTSCQELNQTVEECGGDLQVFSFLIPHRADNSEVCN
SPEDESEWVEDLLKHHTARVRDVEILTGLDLYRSTNLTYIDTLRLKTYLQTFESDD
Download sequence
Identical sequences H2L5B8
ENSORLP00000000985 8090.ENSORLP00000000985 ENSORLP00000000985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]