SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001188 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001188
Domain Number 1 Region: 440-572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 632-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000672
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 341-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000687
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 377-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 657-790
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 785-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000267
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 820-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000382
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 855-917
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000753
Family VWC domain 0.095
Further Details:      
 
Domain Number 9 Region: 300-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001188
Domain Number - Region: 596-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0023
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 268-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0357
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 420-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001188   Gene: ENSORLG00000000972   Transcript: ENSORLT00000001189
Sequence length 1216
Comment pep:known_by_projection chromosome:MEDAKA1:1:2609766:2650720:1 gene:ENSORLG00000000972 transcript:ENSORLT00000001189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEGPKVIAGKSGKSPFNVTIFCCLLRYANCTASGHFELRILSVQNKNGQLQNGACCDGSS
SVLNGRCTGGQCDTYFRVCLKEYQLKVSPVGPCSFGTASTPVLGGNIFSFVNFKNSKARI
LLPFSFAWPRSYTLILEALDFNNDSLSGSVGGALIEKAIHSGMITPSPQWQKLEHNGPVA
QFHFQVRLRCDEHYFGFGCNKFCRPRDDFFGHHMCDHNGNKTCLEGWSGPNCNAAICKQG
CSTEHGFCKVPGECKCLYGWQGQHCDQCIPHPGCVNGSCVEPWQCLCDTNYGGQLCDKDL
NTCGTRQPCLNGGTCSNTGPDKYHCSCPKGFSGVNCQIAEHACLSGPCLNGGSCTENSRG
FECLCAPGWTGPLCSINVDECLENPCSHGGTCQDLVSGFRCICPPQWTGKTCLIDANECD
DNPCVNAKSCRNLIGGYFCQCLPGWRGQSCSININDCHGQCQNGATCKDLVNGYKCECAP
GFGGEHCERDLDDCASGPCLNGGSCHDRVNDFHCLCPPGFSGRRCQLDIDFCLDSPCLNG
GQCFNSVDDYICECPEDYEGKNCSRLRDHCLTASCKVIDSCTVAVASNSTPSGVRLITSS
VCRPHGQCQSHANGQFSCRCEEGFSGTYCHENINDCEIAPCLNGGTCIDEVSRYRCICPK
GWEGPTCENNIDDCSSAPCQNRGVCQDLTNDFYCKCGDGWKGKTCSSRESQCDDVTCNNG
GTCYDEGDAFKCLCPAGWEGSTCNIAKNSSCLPNPCENGGTCVVDGDSFRCICREGLEGP
TCTQNANDCQPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGSTCVD
EIDGYRCVCPAGRTGPLCQEAADRPCVHGGVKALHGSRWNEDCNSCRCLNGRVTCTKLWC
GPKPCSLHSQNLAADCPAGQSCIAVRDEHCFVKPCVGQGQCWGHTHRATPPSGCHSESSC
ANVTFTFNKDIMAKGVTVEQVCHELRSLYAIKNLSSDSSVSVACEPSLRANNEIQVTIIT
DDQRRGLTLIKEVTDRVTDVVSKRSTNSTILQAITEVRIQRRPSQDPSGYLMPLLVSMVI
LVWALAVGSVLLWCLKRRKPGGHTGPAAEDNNALHNSVSAAREQLNHIKNPIEKKPLHHH
LCEDKNSVNFKTCKFESSGSQSDEDEVEKKLQKRRFPLAPPAYSPRHVRSKPPHWTNKQD
NRQLQSQSVNRAELVA
Download sequence
Identical sequences H2L5V1
ENSORLP00000001188 8090.ENSORLP00000001188 ENSORLP00000001188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]