SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001602 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001602
Domain Number 1 Region: 2-448
Classification Level Classification E-value
Superfamily Sema domain 5.76e-116
Family Sema domain 0.0000632
Further Details:      
 
Domain Number 2 Region: 1560-1687,1877-2065
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-47
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 1123-1214
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000602
Family E-set domains of sugar-utilizing enzymes 0.091
Further Details:      
 
Domain Number 4 Region: 1029-1126
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000108
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 5 Region: 451-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000249
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1211-1256,1286-1340
Classification Level Classification E-value
Superfamily E set domains 0.0000000021
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.067
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001602
Domain Number - Region: 605-644
Classification Level Classification E-value
Superfamily Plexin repeat 0.00103
Family Plexin repeat 0.0087
Further Details:      
 
Domain Number - Region: 990-1026
Classification Level Classification E-value
Superfamily Plexin repeat 0.00855
Family Plexin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001602   Gene: ENSORLG00000001300   Transcript: ENSORLT00000001603
Sequence length 2098
Comment pep:known_by_projection chromosome:MEDAKA1:7:2832985:2869684:-1 gene:ENSORLG00000001300 transcript:ENSORLT00000001603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRNDTEFQHLVLHPDPLVERVYIGAKDHLFQLDGSNGLQLEQEETTGPVSDSKDCLPPV
TQLNCPQARRTSNHNKLLLVDPKAQELITCGSVHQGTCQKRSLASIREVLFSTERPVDTQ
YVAANDPSVSTVGLVVALEGGGRTVMYVGRGYTASHPPISTRHLSSEPVFSYEDTAKLAV
AGRLSEYDHHFVTAFTRRSYVYFLFYRRDIKSVSREYRTYAARACLEDSSYYSYVEIPLV
CRSSSFPSRNYNLLQAAQVGQSRSLQGEDLLGVFSTRSSSTNGGLESSALCVFPLEDLDR
HIDSTRDLCYTQDGQVEGRGEVAYIEYEVKSSCANLPPNTLKAYPCGSDHTPSPMASRAP
LEATASWHTSAARLTAVAVSVAEGHSIAFLGDSKGNLHKVYLGEDGAVEVYEHTTVHPNS
PISSDLLLDLNGSHIYIMTKTALERRPVAECGDHLDCQSCLSARDPYCGWCVLEGRCGQR
WECQRGSVHGQWLWSFNQTQQCLSIQHLNLYNISLGEITGVAVSVDGLPSLKQGEAYSCF
FQDTETPALPISSGVICSTPDASSLPPIAPGDDFVMVTLSLRFINVTVAETEFTFFNCSL
VQELSGRRPCQGCISSRWGCNWCIHEHVCTHERSCSRGVTIYNRHYKTQTPTIPPPTTKP
PPSPLSVLTAPTTPPPGGAIITKPPLTETPTLIATTNAPPLPSSPPPSSSSTSPFARTST
QSTTLLSDVITTTERDSNIPTVTDETPRTTLPSSTSSHNESLLKFPEPSSSAISSTTARE
AAPLTLPSNCQDEEDVSPPPSNGWQETEGPAAVEMAASVKHSLVFTPSPETGSHLDPGPA
APVQSDSPSALFVPVSAEELHSVGLMKGFRTKGVDECPCVEKVQDSSLLPVNVERKIRLV
GQHLNLFQDDSMDYECVLDIENQSVVVEAAVEQDVSQPSIFIITCLPHQYDYFLSVEEYL
ATINVRRKNNFLIDSAEDLYVTLFNCSVGRSDCSRCRTADSKYGCVWCGGAGSSRCVFQD
SCTDEIKHSCPAPVIHFLDPVSGPVEGGTVVTISGSNLGQRAQDVQSSVTVAGVPCSVIL
SRYEVSSRIVCETSSSEEERRGHASVEVRGGGGLGVSAQIFSFQDPVLSSIYPQRGPKAG
GSYLTIRGRRLRTGHPSEVSVLIGGVPCLVLDIQDDLINCLSRGSNRTGMHNITVRFGGA
ERHLQGIMYRYTPNPNITDAKPSRSFLRGGRIIRVSGQNLDVVQEPKMRVTLSPPDALPP
RTLKRWRRIVPEAGCPDGALCHVKQYESRCTVNSSSLILCPTPAVGPEAQGARVKVHFLL
DSLHFDFSTVGNGAFSYEPDPKLHPLNQNDQSKPYHHKPGSIISVEGEFLDLAMFKHEVE
ARIGDGLCVVKTLTHNHLYCEPPAHQPSRKQDGMDSLPEFTVKMGNLNFSLGRVQYDTQP
QSTFPLEAQVGVGVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDRCK
KEFTDLMTEMMDMSSDLVGSGIPFLDYRAYAERIFFPGHQESPLRRDLDIPESRRQTVEQ
GLVQLSNLLNSKLFLIKFIHTLEAQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLN
DLVEQYVAKNPKLMLRRTESVVEKLLTNWMSICLYTFLRESAGESFYMLFRAIKHQVDKG
PVDAVTGKAKYTLNDNRLLREDVEYRTLTLNVVMPAADASGGSTVQTVPAKVLDCDTITQ
VKEKVLEQTWKGTSYSQRPHIDSLNLEWRAGVAGHLILSDEDLTSVLQGSWKRLNTLQHY
KVPDGATVALVSRNNKHLLHDSHDYMPGEKTPMLDDGDEGGVRLWHLVKAGEEPEMQKHR
KGTMRERGGERAKAIPEIYLTRLLSMKGTLQKFVDDLFTAILSTSRPVPLAVKYFFDLLD
EQAQQHGITDAETIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQTFMDS
CTIADHKLGRDSPINKLLYARDIPRYKQMVERYYTDIRQTISASDQEMNSALAELSRKQN
YAPEVNCLVALNELYKYINKYYDQIITALEEDCTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2L6Z4
ENSORLP00000001602 8090.ENSORLP00000001602 ENSORLP00000001602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]