SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001798 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001798
Domain Number 1 Region: 15-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-46
Family DBL homology domain (DH-domain) 0.0008
Further Details:      
 
Domain Number 2 Region: 379-556
Classification Level Classification E-value
Superfamily PH domain-like 4.73e-27
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 3 Region: 211-331
Classification Level Classification E-value
Superfamily PH domain-like 8.99e-22
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001798   Gene: ENSORLG00000001453   Transcript: ENSORLT00000001799
Sequence length 558
Comment pep:known_by_projection chromosome:MEDAKA1:5:2102218:2117469:-1 gene:ENSORLG00000001453 transcript:ENSORLT00000001799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVVIYAFKVIKPDGQSRAFYVVMDLVETERVHVNSLKMLQEDFRDAVGLAVGDEGQPVLD
DGRLGEILNELPDVYTLHRKILSELEYRIRHWEEWQRIADIFLSRKAEFLVFTTYIGHYD
RSMSLLENSCQTSPAFAAIVQKFETQEQSSAVSLKQQLLQVIVRVARYRMLLTDYLNNLS
PDSREYEDTQAAVGIVSDIADQINDNIKHGENLLRLINIAHSVHGQRDLLHPDRVFVKEG
TLMKVSRKSRQPRHLFLMNDVLLYTYPQQNGKYRLKNTLSLTGLKVSKPTIDNAPNALKI
EGTDISIILSASSFLEREDWFYTLNRTVTEHTRGSAFNSCSGESRDGLKLLLGEKAPTLV
PVSQVMMCMNCTADFSLTLRRHHCHGCGRIVCRSCSRNRYPLKYMKDRMAKVCDHCYSEL
KKRVEPGNVKRLGKGLSLLFNQDREGVSECFGQVTVSEEGSISGTLQRSKKSKKNWKRLW
FLLKDKVLYTYRAQEERIASESLPLLGFTVKLSDKYAGEEETNVFQLYHKDTLFYSFKAE
DNFTAQRWVNAMEEATNL
Download sequence
Identical sequences H2L7I5
ENSORLP00000001798 ENSORLP00000001798 8090.ENSORLP00000001798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]