SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001837 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001837
Domain Number 1 Region: 1513-1714
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-51
Family DBL homology domain (DH-domain) 0.0000148
Further Details:      
 
Domain Number 2 Region: 917-1096
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-49
Family DBL homology domain (DH-domain) 0.0000000521
Further Details:      
 
Domain Number 3 Region: 1711-1829
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-34
Family Pleckstrin-homology domain (PH domain) 0.0005
Further Details:      
 
Domain Number 4 Region: 1106-1222
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-32
Family Pleckstrin-homology domain (PH domain) 0.00000368
Further Details:      
 
Domain Number 5 Region: 501-643
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 172-309
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-16
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 7 Region: 731-870
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-16
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 8 Region: 37-154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000117
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1285-1351
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000079
Family SH3-domain 0.0038
Further Details:      
 
Domain Number 10 Region: 307-416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000588
Family Spectrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001837   Gene: ENSORLG00000001484   Transcript: ENSORLT00000001838
Sequence length 1844
Comment pep:known_by_projection chromosome:MEDAKA1:2:17646152:17686885:1 gene:ENSORLG00000001484 transcript:ENSORLT00000001838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFMQSLAEVGQNHQHALDLQTQHQHFTANCMNGSVNVDSVVTVAARLAEAGHYGAERIAL
VSSKLQDNWKSMTSALEERSNMLAMATGFHQGAEQFLARVEGWVKLCSEGPLPSTTAELE
PAIKKHQELNEEISANYTQVSESGKALLEVLQRCPTTDSDESATKPDFTAATHTIMGVLH
QVMQGHHEVEGAWQHRKLRLHQRLQLCVFQQDVKQVLDWVEQHGEVFLNKHTGVGKSLHR
ARALQKRHDDFQQVAQNTYTNAEKLLEAADQLAQSGECEEEEIYQAARDLELRMQAFIQR
VEQRKLLLDLAVSFYTHTKELSAWMEGLQKQLSSDLLVCPDTVEALQALISQQQQQQTNT
QEAAMSVIREGEDLILQLRYTKMPQGSSVAHVESVLQQLEESHVQLEELFHQRKIRVDIF
LQFRILHQCTLEVTAEMDAWKMDLEKQSQEFSPEALTLAQQRIHRHMERRLAMNNMIYEV
IQQGHDLQQYISEVQASGIELSDVEGGLSSQVEELQRLLQDKQKELQQIADHTHTLLEQN
LQLRHLQSQVKQVLGWISEGEVMLSSCMLNSSCLSEAEQLQKEHERLQQAIERTHQVALA
LQQRAELLVRSGHYDPDAVRSCAQTVALHWQTLMLRIEDRLKLVNASAAFYRTSQQVCGV
LESLEQEYRREEDWCAGGERQPEQLLPLINKHMEQKEAFLKACTLARRNAEVFLKYIHRN
SVTMVTGHSRVPEQQVKGILSELLQRENRVLHFWTLKKRRLDQCQQYLMFQTHAQQALDW
LQQSGDHYLATHTSPGATMAETQELLNQYREFCISAKHTQEKVHLLIQLAESMLAKGHTH
RTELRRCVSTVDKRYRDFSVRMGQYRHLLETALGGCSQDNKDLELELIPNSLSDSDPEVN
LSDPSHQVSDEKRRSARKKEYIMAELLQTERVYVRDLQECIETYLWEMTSGSEDVPLGLA
NSHYTVFGNIQDIYEFHNSIFLKELENYEQLPEDVGHCFVTWADKFHMYVTYCRNKPDSS
LLIQQHGVGFFEEVQRRHGLANSISSALIKPVQRITKYQLLLKELLACCEEGKGEIKEGL
DVMLSVPKRANDAMHVSMLEGLEDGVEVQGELLLQDSFLVWEPKSLIRKGRDRHLFLFEL
SLIFSKEIKDSSGRTKYLYKSRLRTSELGVTEHIEGDQCKFALWVGRTPTSDNKTVLKAS
SLELKQEWVRSIRQVIQERRGHLRGALREPIPLPKTPNPTLGRQRSITRRETSEDADSLG
DASSQPDTVSIASRTSQNTADSDKLSGGCELVVVLLDFTSGGPGELSVRCGQTVELVERS
ADRPGWCLIRTTDQTPQQEGLLPMSALCLSHSHSAGDMEDSWLFVFADSSLFSSEGSGLP
TQTSSQSKKIISAVGSPGPKRSGSGTGNTLKRWLTSPVRRLSQGKADGQKKPPIRARRRD
NKLELATPLTVNTQMGAKQTCFSNQQKARKEEAGQSGGEEEQEEESHTPLPPPMQIMKDP
NNPEALDSDQGSNESDTEQRNKALRGRMFVVNEMVQSEKDYVKDLGVIVEGFMSRLEVRG
IPEDMRGKDKIVFGNIQQIYDWHRDFFLVELERCIQNHDLLADLFIRHERRLHMYVVYCQ
NKPKSEFIVIEYETFFEEIQHEISCRMSISDYLIKPIQRITKYQLLLKDFFKYTTKAGLD
TEEIEKAVELMSLVPKRCNDMMNLGRLQGYEGKLTSQGKLLQQETFCVWEQDGGVLSRSK
ERRVFLFEQIIIFSELLRKGSNNPGYQFKNSIKVSYLAMQDSVDGDPCKFVLWSRGSAER
FTLQASSASIKMTWVETIATLLDAQNNFLSALQSPIEYQRKEGG
Download sequence
Identical sequences H2L7M1
ENSORLP00000001837 8090.ENSORLP00000001837 ENSORLP00000001837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]