SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002165 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002165
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 783-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 676-739
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 4 Region: 153-206
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000732
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 631-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 89-151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 738-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002165   Gene: ENSORLG00000001743   Transcript: ENSORLT00000002166
Sequence length 869
Comment pep:known_by_projection chromosome:MEDAKA1:3:10040974:10073693:-1 gene:ENSORLG00000001743 transcript:ENSORLT00000002166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWSQLLFQETNPGVHYEYTISRITSEDTNSGSDYFWKYGSWTECSATCGIGVQRRAVFCV
EKTTGLVEDHFCEPSLRPEDNHISCIKDPCPAIRWWVGDWQKCSASCGSLGLTKRTVLCI
QAVSAEEQKALEPSFCAHIPKPESISSCNTLMPCPADWNTGRWSKCSHTCGNGVRQRNVT
CSRNTGVDCDPQKKPLAVTECYIQDCLQLGDNFGDSEGSGSGMSSNEVQNEINPIPELKT
PLKPGRGQSRNPNVNFDFHYHNNIERTEENNVQVDDFYYDYNFIDFHEDLSEDFRSREKN
LEDSHRLLSEVEQTHSVGADARVDTGNTTIAASAAPNVSDIYDLKHMEPQNITGDDIKHI
STTENSKDANDFLSEDYLLPVSNTYLPPLSKTPRSQIAKGEHESVLWPESIITSGLLVTT
EHPAQDETWEESGDETENAYDDSRAEENHSQGFTVTAVHPAPTRIHQTTTDITSTMEINS
KSLSLEEKNDVTSKPLDQPAETEIPVRTGIHLKEIFQTTTAIPSAFTLEDLEMDPNILEA
QRNSWDNDLSTLPPPSTFLPSLLLQTSVGSNINPDLIHQAATNTQATTQSSLTPAHHVEQ
ATPTVPIISTNAPSLWPRTVPSSVEASGGAGHWVAGNWSACSTSCGLGAVWRAVTCSTGK
DSDCHSSKKPPPARQCYLRPCSMWKVGEWSKCSKNCEGGSKFREVQCFDLRDQRPLRPFH
CRAMSSRPQSQNLCNLQPCLDWYTSSWGQCSEVCGGGEQQRIVTCPEENGCEKDLQPSNI
QSCNSQPCAQWLTGSWGECSASCGGGVQQRLIKCVDTKADTDTEVDQGQCHHELKPVGSQ
KCNTQECESASPRFCSKNSIQTLLCKLLQ
Download sequence
Identical sequences H2L8J2
8090.ENSORLP00000002165 ENSORLP00000002165 ENSORLP00000002165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]