SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002436 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002436
Domain Number 1 Region: 201-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.05e-55
Family Reprolysin-like 0.00061
Further Details:      
 
Domain Number 2 Region: 498-554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000314
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 1476-1534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 907-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 783-841
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 6 Region: 1424-1477
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 837-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002436
Domain Number - Region: 1327-1369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number - Region: 1364-1428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002436   Gene: ENSORLG00000001958   Transcript: ENSORLT00000002437
Sequence length 1577
Comment pep:known_by_projection chromosome:MEDAKA1:9:5017380:5038934:-1 gene:ENSORLG00000001958 transcript:ENSORLT00000002437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVVHPVKTSADGEFISNEVSHHFNMGRHRRDLQGQPPQRQVYYQLSYKGRNLKFNLTAN
EHLISNDYVLEKRKDNTTEHRFFQGNSCHLIGTVEASGVRGTAAISTCKGLTGFFSLPEG
HFFIERVQKSPDDAAGLPQPHIIYPKASSGIHRQKRDSEPEPTRSPCGVQAEKESTFACN
FFHCRRFRRSKRLHPGHRSVSRERWVETMVVADSKLIEYHGSEHVESYIFTIMNMVAGIF
HDASIGNAIHVILVRLILLQGQEKGLKIVHNADTTLASFCAWQKHLNPQNDAHPAHHDLG
ILITRKDICAGMNQPCETLGLSHLSGMCQPHRSCNINEDSGLPVAFTVAHEMGHSFGIQH
DGQGNDCELQGRHPFIMSRQLMYDSSPLTWSSCSKDYITRFLDRGWGFCLDDRPSKRDIA
TPLARLGIRYTTHHQCQLQYGPNATFCPEVDNVCQILWCSVNGSCRSKLDSPIDGTRCGP
EKWCISGECVIVGKLPETVNGGWGQWSTWSYCSRTCGTGVQSAERECNNPKPEFGGRYCT
GERKRYRTCNTKPCQRDKPTFREMLCSEFDTVPYHNELYHWIPVFSPTNPCELHCQPVGE
FFSERMLDIVTDGTPCFMNNKSRNICVNGVCKDVGCDYGIESNAVEDRCGVCLGDGTSCQ
TVSKSFDQGEEFGYVDVGVIPEGARYISVKEASEVGNFLALKSVESEEYFLNGNFIIQWN
GEYEVGGTTFYYERNGNVENLTAPGPTKHPVMLQLLIQEKNPGIQYEYIIKKTKDSENEV
TEPIYFWRHGAWTACSTTCGSGEQHQPVRCFQADMGVVDESLCDSDSRPDDKLRQCKNME
CPARWWVGSWQQCTATCGSEGVRKRTVLCVRTVSWEERVLHPVECKHLLKPKPVVPCNRD
VPCGKDWAVSSWGECSATCGGGVRSRNVTCALTPRKACNLAAKPRSRSLCALQNCPNSSL
YRKPGFLSMSRRISPPRTPPSQHPGTTAAPTSTKKEATTNFILKTTSLPDFEHTTPEIID
ADGFDFSFGMRKIENPKNSTKTEKQKQVTLIEDENLEEGSTPTMLMYTAGYDYVVEDMTT
AAEDKISDMEVFTTATSPKSFLQVTPSKPQKSPVTMHRIRAPATTTNPVPFTSTQTTEHI
SNLSITPNISQGWTRRNPLITPSYRNRAGSPKTDTQTKRAPSVTPRKSFTTAPSPHPTPT
ITMRKSAATLEDNSSSSRPTETSSKFKSGGSKNQNQKQKTPQSSLVSHQNKLKARETARE
TASMDVFWIVGNWSEFLSRKCKKAIDMVPCSLPDSLSQNIQHKTCLYFQTKYTSIELSFK
EKRPFFPQCSTTCGIGAVWRAVTCSSQNEEDCAKMKRPEPARTCHLQPCATWQAGSWSKC
PDDCALVKRRFRDVQCVDAQSKRPLRPFHCQAVSSRPLSTLVCPHNPCMNWDVSPWGPCT
GICGEGVRERRVFCAEPHHCSTTQRPNSTEPCSLEPCAHWKSGDWEECSVSCGGGQQRRS
VKCVTGRESAVVPNSRCEKILKPVTLRMCSMQECSSENVSRTCRKNAISSRFCEKLKLLG
RCTLRSVQRQCCVTCRP
Download sequence
Identical sequences H2L996
ENSORLP00000002436 ENSORLP00000002436 8090.ENSORLP00000002436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]