SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002529 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002529
Domain Number 1 Region: 516-706
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-50
Family DBL homology domain (DH-domain) 0.000000255
Further Details:      
 
Domain Number 2 Region: 714-838
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-33
Family Pleckstrin-homology domain (PH domain) 0.0000149
Further Details:      
 
Domain Number 3 Region: 171-323
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000993
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002529   Gene: ENSORLG00000002026   Transcript: ENSORLT00000002530
Sequence length 840
Comment pep:known_by_projection chromosome:MEDAKA1:14:7955969:7966486:1 gene:ENSORLG00000002026 transcript:ENSORLT00000002530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESNPMRGFPRLRRAATSFPGNLHLILVLRPSSLLSPAPSPSSSTDLGFRFSQDDFLLK
MPVVMLRSVGDLLRYIDENHLASDFSAKVEYCQSDWLILRSSIESFAVTVKEIAQLLQSF
GSELSDTELPDEANAIEFLLHSHTHRYKQMKDDIRGVLKEGRLLFSNLETVKAAKKEIEE
EREIQADMETVRRLLAQLRDMEEAFDGFFDKHHLKLQQYLQLLHYEISFQQMEEVLERLS
AQEKEIASVGTTVVQTEQLLKDLETLDNHAQEEMARAQVVILHGHQLAANHHYALALIVQ
RCNELRHHCDVITAAVRTKRASLTRTRDLLLRLEQALRWCDEGAYLLASQMVDKFQTKEG
AQEALQYLSCHQERAPSAVKNCQDSLSFDFEAVLTPQLESQINMVTEKLNSVQSMIRNRE
QCLRKLADVQVRPIQLVAPRPEPDQTVLRCKSPLFSPKHVLGVDFSVLNSKFSFDLLPGK
RATKKNNSQRKIEVMHDYQGNRSSLYGPIPETDSETEDNPEQVTRHIMKELISTERIYVD
ELLSVLLGYRAEMEDPSMSNLLPSALRSQKDVLFGNMPEIYQFHSRIFLQDLQDFLETPE
RVGSCFLQRKDNFQVYERYCQNKPRSELLWRQCSDSPFFQECQRKLDQRLGLDSYLLKPI
QRLTKYQLLLKELLKQSTVEQYRSELQEALSSMLELLKSVNDSMHQIAITGYQGELSQLG
RVVLQGSFTVWISYKRAAVRMKELARFKPMQRHLFLYENALLFCKRRDEDNHDRTPFYSF
KSCLRMNTVGLTETVKGDVKKFEIWYSGREVVYVVQAPTVEVKVSWLTEIRKILTNQQKL
Download sequence
Identical sequences H2L9I5
8090.ENSORLP00000002529 ENSORLP00000002529 ENSORLP00000002529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]