SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002666 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002666
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.57e-30
Family Frizzled cysteine-rich domain 0.00000194
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002666
Domain Number - Region: 255-422
Classification Level Classification E-value
Superfamily MetI-like 0.0543
Family MetI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002666   Gene: ENSORLG00000002147   Transcript: ENSORLT00000002667
Sequence length 524
Comment pep:known_by_projection chromosome:MEDAKA1:17:1136945:1138516:-1 gene:ENSORLG00000002147 transcript:ENSORLT00000002667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKKPLPPCRGVCERAKAGCA
PLMRQYGFPWPDRMRCDLLPEQGNHDSLCMDYSSQTTTVSPALAKPTNRPLKPYNKRKGP
YGRTFPGKHKPAGSPCEAACSCRAPMVPVSSEGHPLHNRVRTGQIVNCAVPCYNPYFTQE
ERTFTSFWIGLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLV
AGHEEVACNMWNGAGYIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKW
GNEAIGSYSQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGVCYVGNQNLDSLRGFVLAPL
VIYLVIGTMFLLAGFVSLFRIRSVIKQGGTKTDKLERLIIRIGVFTVLYTVPATVIVACY
FYEQHNRQAWEITHNCTCATEPSKQRPNYAVFMLKYFMCLLVGITSGAWIWSGKTLDTWR
TFCRRCCWGSKASASSMYSDVSTGLTWRSGTASSVSCPKQMSLS
Download sequence
Identical sequences H2L9W7
8090.ENSORLP00000002666 ENSORLP00000002666 ENSORLP00000002666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]