SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002676 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002676
Domain Number 1 Region: 376-594
Classification Level Classification E-value
Superfamily Bet v1-like 5.71e-40
Family STAR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 31-118
Classification Level Classification E-value
Superfamily PH domain-like 1.49e-20
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002676   Gene: ENSORLG00000002149   Transcript: ENSORLT00000002677
Sequence length 603
Comment pep:known_by_projection chromosome:MEDAKA1:12:2399354:2418262:-1 gene:ENSORLG00000002149 transcript:ENSORLT00000002677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNQSWNSSGSEEDLEPKEEYGQAAGVAEFSGVLSKWTNYIHGWQDRWVVLKNNTLSYY
KSQDETEYGCRGSLCLSKAVITPHEFDECRLDISVNDSVWYLRAHDPYHRNQWIDSIELH
RVDSGYGSESSLRRHGSMLSLISATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQV
DTLQKYFDSCADAESRDEFQRDKIMEDDEDDFPSTRTDGEFLHNNNGSREKLFQTLSLKG
INGIDFKGEAITFKATTAGILATLTHCIDLMVKREDSWQKRLEKEMEKRRRIEESYKSAL
TDLKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKMEEQCQTEKTRVQRSSPVPP
GDVYSSSGSHRFADKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVL
DPLKATHSVKGVTGHEVCHFFWDTAYRNDWETTIENFSIVETLSDNAMIVYQTHKRVWPA
SQRDVLYLSAMRKMVTNNENDPDTWLVCNFSVDHDDAQVSSRCVRAKINIAMICQTLVSP
PEGDKEISRDNLLCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTASKP
ILF
Download sequence
Identical sequences H2L9X6
ENSORLP00000002676 XP_004074547.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]