SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002704 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002704
Domain Number 1 Region: 601-741
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.31e-19
Family Glycerol-3-phosphate transporter 0.02
Further Details:      
 
Domain Number 2 Region: 519-590
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000392
Family Pentapeptide repeats 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002704
Domain Number - Region: 161-215
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000562
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002704   Gene: ENSORLG00000002175   Transcript: ENSORLT00000002705
Sequence length 752
Comment pep:known_by_projection chromosome:MEDAKA1:12:2450934:2475537:1 gene:ENSORLG00000002175 transcript:ENSORLT00000002705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFPCAEMDEAHNNRTSLAKGAKDIAKEAKRHAAKNLSKAVDRASDEYSAHRSYNRFHNDD
QEEDNYNNYVQQDGTYPNNADNDEDGASSDATEGHDDEDEIYEGEYQGVPAYNDGKVQDS
QVALGKPVSDSAKSRKELENERQADEEELAQQYELIMQECGHGRFQWQLFFVLGLALMSD
GVEVFVVGFVLPSAETDMCVPNSGAGWLVSLVMSTVVQVVGYFYSGTERRKEHHKCPFFE
KLLLYRWAYLTTGTTFVSQNGIYSTCSLVLTHLPVGERIASMSHLIKDVHKYSRIEMDLK
HMTFLCFWVVGNLINLKNFFKLTPQMFYHHFWSFDFSKNFSFHAVFVIVVFCSFNEMFLS
GVLELKKESPQCSLKTGGHDELSLKLLKVHCDPAEKRGKNVFRLSHSQSRGAGDSVLQSL
SDVATQIRRWYLPVPNAALLILGGDTWEPCFHLPLRKPPLRRRQWLRLSPFPFSVSVPSP
ARLRRVSFLCSAIFLPGAASSNEHISTHISIFISTNRGKVCFKFKRFISMKFKAVTFIDS
SFFNCYFEDVSSVGSFFKNCSFVDSFFYNTDIDDTKLTNSRIINSSFHHNKTGCQMTFDN
DYSAYWVYFVNFLGTLAVLPGNIVSALLMDKIGRLSMLGGSMVLSGISCFFLWFGTSESM
MIFMLCLYNGLSISAWNSLDVVTAELYPTDRRGTGFGFCNAMCKLAAVLGNLIFGSLVGI
TKAIPILLASSVLVGGGLVGLRLPDTRANVLM
Download sequence
Identical sequences H2LA02
ENSORLP00000002704 ENSORLP00000002704 8090.ENSORLP00000002704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]