SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002729 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000002729
Domain Number - Region: 51-133
Classification Level Classification E-value
Superfamily Bet v1-like 0.00714
Family Phoshatidylinositol transfer protein, PITP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002729   Gene: ENSORLG00000002200   Transcript: ENSORLT00000002730
Sequence length 205
Comment pep:known_by_projection chromosome:MEDAKA1:18:254028:255980:1 gene:ENSORLG00000002200 transcript:ENSORLT00000002730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRYFHSEVHILSPWDQVVAAFWQRYPNPYSTHVLTEDVLYRELTPNNHLLSRRLLTKTN
RLPGWAERVFPAHVARAVYVLEDSIVDPQTHTFTTKTWNLNHNKLMVVVETCLFEEDHSR
PSWTKLKREAWISSAVYGLGRPIQEFGLARFRSNQAEALRGLELALLRMQTEAPPNHHGN
QDESSEKHKPIPTKATPTPKPHPFI
Download sequence
Identical sequences H2LA25
XP_011485448.1.28442 XP_020567076.1.28442 XP_020567077.1.28442 ENSORLP00000002729 8090.ENSORLP00000002729 ENSORLP00000002729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]