SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002926 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002926
Domain Number 1 Region: 317-575
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-81
Family Eukaryotic proteases 0.000000244
Further Details:      
 
Domain Number 2 Region: 102-207
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 209-303
Classification Level Classification E-value
Superfamily Kringle-like 2.69e-29
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 4 Region: 34-79
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000345
Family Fibronectin type I module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002926   Gene: ENSORLG00000002355   Transcript: ENSORLT00000002927
Sequence length 580
Comment pep:known chromosome:MEDAKA1:9:5369457:5380350:-1 gene:ENSORLG00000002355 transcript:ENSORLT00000002927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSVHLFFLLSVLCCSLADNAEQPRSKRGARFYRVLCVDSETSAVHGYGDTWLRWKGQR
VEYCHCALRGQERCHSVPVINCYASQCYNGGTCKESVYTSDYICQCPQGFKGAQCEINSN
EKCIVGKGEGYRGTLSVTHSGEECINWNSTSLRGKKFTARKTDASGLGLGNHNFCRNPDQ
DSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPA
VRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSRAPSTI
TTLGPRAPTTNNNQATCGQRLDNTLSRPAFRIFGGRGSDITEQPWQAAINFYVPRHKRHF
HLCGGVLIDSCWVLSAAHCFQEKDKPEILQVILGRTFRTQNSNSEQIFKVEKLWIHEKFD
SETYDNDIAILKLKTDIGLCAVNSEEVLPACLPDRGLELPDWTECEISGYGKSSEFSPEF
SERVKRGHVRLWPKERCTPDVLSERTVTSNMLCAGDTRGKDDACKGDSGGPLVCRNQNRM
TLMGLVSWGDGCGEKDKPGVYTRVSNYIDWINRKIRVNPV
Download sequence
Identical sequences Q50LG7
ENSORLP00000002926 NP_001098301.1.28442 8090.ENSORLP00000002926 ENSORLP00000002926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]