SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002984 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002984
Domain Number 1 Region: 13-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000151
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002984   Gene: ENSORLG00000002399   Transcript: ENSORLT00000002985
Sequence length 313
Comment pep:known_by_projection chromosome:MEDAKA1:19:285914:296546:-1 gene:ENSORLG00000002399 transcript:ENSORLT00000002985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDLCLAINATISPSPFTVAQEGQNITLTCIVSQRRRNSALPVVKWTFLPVGADRPEDELL
IARVNMRKARFYGNYTKSFTWPKMKLTVVKHGKIFEMLILNVSVDDRGLYICRVQEFKKH
QDRWKAASNCTAATELRDFSFTKCSERKYSEEKESLWSLFEDVYLCAVLICSIGLLCMCT
FTVTLTCQFIKERQRLNDSYLLVKSPHNSSGETVISEVNVSPALPKKERRYRKKRTKGFQ
EELPPEIPAKAPIRDKTCKPKLLKPQPRKVLLPRIVEENLTYAELELIRPPPDMKTSCSG
TVYAQILFKEQKL
Download sequence
Identical sequences H2LAS2
ENSORLP00000002984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]