SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003168 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003168
Domain Number 1 Region: 127-275,318-333,403-445
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.32e-46
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 19-57
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000366
Family Somatomedin B domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003168   Gene: ENSORLG00000002546   Transcript: ENSORLT00000003169
Sequence length 459
Comment pep:known_by_projection chromosome:MEDAKA1:14:8477680:8485761:-1 gene:ENSORLG00000002546 transcript:ENSORLT00000003169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALALLSLLLVVESTSAAEESCVGLCGSFDPERKCQCDSMCVYYSSCCGDFSNICAKKGKS
SSGIPLFNHICDLILQPNSTKTQWPLKSVENTTAIVTPNVSSAAPTVQSSSAPQPTSTFG
PTAHTDPDAAPCSGRPFDAFLQLKNGSIYAFRGDYFFELDDDSILPGYPKLIQDAWGISG
PISAAFTRINNLFCPTGVFLLQGSRYWRYNGNVLDEGFPRDISEGFQDIPNDIDAAFTVP
APNHRGKEKAYFFKGDKYYKYEFKHQPSHEECVQMTKASPSVLFTQYTDLFCDQTAEDLF
TGLFGSSFDSQRTNPRFISGDWHGIRPPVDAAVVGRVHLSVKPTASPPRRGSSRRRGSSR
RRGPHRRRLSHRWFGDLWNDDDFAFSMDESDFTDQSTTTDNRQIPVQNVYFFKKDKYYRV
GLRSKRVDFANPPYPRSIAKYWLGCKEEEMPDSSRAEKK
Download sequence
Identical sequences H2LB99
8090.ENSORLP00000003168 ENSORLP00000003168 ENSORLP00000003168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]