SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003361 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003361
Domain Number 1 Region: 17-109
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-33
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003361   Gene: ENSORLG00000002697   Transcript: ENSORLT00000003362
Sequence length 112
Comment pep:novel chromosome:MEDAKA1:11:5834079:5834414:1 gene:ENSORLG00000002697 transcript:ENSORLT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLSVSVSVSSESRGQVTVTQPGAVSSAVGGSVSISCRTSQDVYNNNFLAWYQQKDGET
PKLLIYYASTRASGTPTRFTGSGSNSDFTLSISGIQAEDAAVYYCQSLHIIN
Download sequence
Identical sequences H2LBT2
ENSORLP00000003361 ENSORLP00000003361 8090.ENSORLP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]