SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003520 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003520
Domain Number 1 Region: 33-487
Classification Level Classification E-value
Superfamily Sema domain 1.07e-103
Family Sema domain 0.00019
Further Details:      
 
Domain Number 2 Region: 1328-1455,1653-1838
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-42
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 833-928
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.008
Further Details:      
 
Domain Number 4 Region: 490-539
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000802
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1017-1091
Classification Level Classification E-value
Superfamily E set domains 0.000000252
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.046
Further Details:      
 
Domain Number 6 Region: 925-989
Classification Level Classification E-value
Superfamily E set domains 0.0000146
Family Other IPT/TIG domains 0.025
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003520
Domain Number - Region: 790-824
Classification Level Classification E-value
Superfamily Plexin repeat 0.00889
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003520   Gene: ENSORLG00000002814   Transcript: ENSORLT00000003521
Sequence length 1867
Comment pep:known_by_projection chromosome:MEDAKA1:6:6943520:6981960:1 gene:ENSORLG00000002814 transcript:ENSORLT00000003521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHNYRWIFTEMACWVSFLLFLFCQSTSHADPIKEFPTKTLINNVVQDRQTGRIYLGAVNN
IFQLGPSLQFEASAETGPKEDSPTCTPPASSCHDTSPMPNTNKLLLVNQNNGSLIVCGSR
YRGICSLRDLSNVGKELYYTDNKGEKTYVASIEDDVNVVGIMSNHTKDQTTFDVFFVGKG
YGSQDSAILISTRILQDFQDWVVFESISEPAVVQTKSYAPKFMHDFRFAFEEGGFIYFLF
SRTFDGTDNKILTFVSRLCKNDSYYYSHTELQLNCGTKNQYNKVQAAFVGSPGKYLAQEL
IDKNIIGNRDAMSKVLFMVASSDDDKSALCMYPLGSINGRLMEIISACYSDSGKISNKPA
VYAPYFSPKDIVCSSNKDMLDQYKCGADFLPSPLASRPEFAFKADPVWETQGFLTAVAID
VENDHTVAFLGNNQGEVFKVHLAKKAEHYGTIPGDGMRENVNRNLFFDLSHNHIYITTER
KITKVPVQTCLQKTDCQSCMDLKDPYCGWCVLEGRCTRRSECKRAEEKNGWLWSPAQQCV
KIASFSPPNFSREKRGSSVRIHIQPFPAIGPSDQLQCKIDSFLTEGLLQDSGQVFCLLPH
PSLVPPTPEGQEFHRVQSWGLKSKNKNVELATKDFRFYSCAATVRCMSCVASAWECQWNI
LDHTCNDRSSSCNFKRMSCPRFENPDPSLIPVGVKTPISFEGMHLNQVKHCNQSCACVLS
FRNNTERVKYIVEDHLNSIFSAANQPTCWLFSFVELSLFFKGIKGFMTGDFLFLCFVHLS
VTLYNCAKGREDCSLCKYADSKYKCVWCRKQNKCVFEKLCGTHQDEDLQNVQCPNPEITD
VKPLYGPLNGSISITIFGSNLGIHKEDIKSITVAGEPCIHQKEKYSVSKSVVCEIGPKRK
PPNEGKVEVEVNDNKRGMSRFSFTYRDPVPTAVKPSRGPKAGGTLITISGKFLETGSKVD
VQMKQQKGLDREQFGEEITCRTGEYKGEKVPSEDLPITLKYGKSTSRTIQKAFKFLENPT
VLDHTPKSSFVCGGRTIVVTGSGFDPIQTARLMVQGDNSSHDELAEAKNDTFIKFSSPQI
KGSLNQHLKTYIYLDSFVKELKPFDYYSNPTFNNLTKMIIPRTSLIVIHGRGFSKAMTVK
ETEAYVGDVKYDVTVLRDDNLFLVPPDKESQTSATWNETSTNKELDIRIKFGKSEFKAGS
VQYERKNDLSLYIIIPAVIVPMLLIITISVYCYRRKSQQAEREYEKVKHQLENLEESVRD
RCKKEFTDLMIEMEDHTNDLNEGGIPFLDYKTYTDRVFFLPSKDGANDVMITGKLDIPEA
RKNTVNAALNQFSNLLNSKTFLINFIRTLERSHDFNARARVYCASLLTVALHGKLEYYTD
IMRTLLLELMEEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDSAGEPLYKLFRA
IKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYSVLVLVQGEGLDVTYVKVLNCDTISQV
KEKIIEQVYRNLPYSQRPKADGVTLEWRPGSTGQILSDLDLTSQKEGRWRRINTLAHYNV
RDNATVVLSKVSHTLHNYDQNQENHENPCLSFVSWEIFSVSPLSLNMQFPPIGNALLDDD
KVFHLVRPAEELDEFKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQFVDNFFRSVLCS
GAVVPPAVKYFFDFLDEQALKHNNVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHVSE
VVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAKEISTYKKMVDDYYKDIRLMVPVS
DQDMNTHLAEVSRSHTSKLNTQVALHQLYQYASKYYDEIIKSLEDDPAARSKNLTTRLNQ
IAAALEN
Download sequence
Identical sequences H2LC84
8090.ENSORLP00000003520 ENSORLP00000003520 ENSORLP00000003520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]