SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003703 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003703
Domain Number 1 Region: 36-150
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.66e-33
Family Frizzled cysteine-rich domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003703
Domain Number - Region: 167-277
Classification Level Classification E-value
Superfamily TIMP-like 0.000337
Family Tissue inhibitor of metalloproteinases, TIMP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003703   Gene: ENSORLG00000002964   Transcript: ENSORLT00000003704
Sequence length 294
Comment pep:known_by_projection chromosome:MEDAKA1:6:7188598:7190439:1 gene:ENSORLG00000002964 transcript:ENSORLT00000003704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NATRTCAQKGLEDIYTRLTLSCSFSTLYFVFIHQSTRCVAIPNQMKVCRGVGYSEMRLPN
FLGHSNLEGEVVPHSEDWRPLLQTGCHPQAQAFLCSIIAPVCLDAFIQPCRSLCVAVRDS
CAPVLACQGHLWPEALDCDRFPDEEDMCLTPYAKLNHYSKDVPKPACQNCPSVEDAPAVK
TVLGAFCRHDFAVTARIHRSRHPGDESEFQIEGRVEFIRQGPLLPYDTQHLLQQWLLINV
RCASALVRPARSQLYVLTGSVLPDGTIALTYLFPWHKKDAGIALATRKWKHHRC
Download sequence
Identical sequences H2LCR3
8090.ENSORLP00000003703 ENSORLP00000003703 ENSORLP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]