SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003773 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003773
Domain Number 1 Region: 31-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-39
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 379-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000165
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000303
Family VWC domain 0.016
Further Details:      
 
Domain Number 4 Region: 688-760
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000722
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 521-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000643
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003773
Domain Number - Region: 332-397
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.076
Further Details:      
 
Domain Number - Region: 629-694
Classification Level Classification E-value
Superfamily FnI-like domain 0.00492
Family VWC domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003773   Gene: ENSORLG00000003018   Transcript: ENSORLT00000003774
Sequence length 813
Comment pep:known_by_projection chromosome:MEDAKA1:6:7206632:7305593:1 gene:ENSORLG00000003018 transcript:ENSORLT00000003774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAFILGKLFLVLCIFFASSGFGVDPALRISVFDELRLGDGFDGLTQVQGFHSETRAFHFQ
GSSREVRASAEVSAQMLKKLKGKNEFTVLATVKQDRLNSGVILSVHQSDHRFLELESSGQ
RSEVRLHYRTKNQKDHTEVFPYSLADDQWHKISVAVSASHVILHVDCNRIYERVVEAPSM
DIPEDTSFWLGQRNAAHGFFKGVMQDVEVLVMPQGYISQCPDLNRTCPTCNDFHGLVQKI
MELQDILAKTSSKLSRAEEKMNGLDGCYCERTCSVKGVIYREDEGWTDGCKNCTCTNGTV
HCEAISCPPPQCPAGTAPAYIKGACCKECQPVCLFGGRELVEGDQRAVRDSSGRCLLFEC
RDRSMHRVVPSEPCPELSCPESEQIALSNRCCKVCRGHDFCSEGHGCLEHSDCVNLEAGD
CCVCKDGFRPLRDDNAYCDDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDDYSC
TEHDECLSGLHNCDENALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVSPNK
CVCQQGFTGSRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSANGESC
VDINECKTGRNTCANDTVCFNLEGGYDCRCPHGHNCTGDCIHDNKVKHSGQIWVLDNDRC
SVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCLHQNGLLTYGSGDTWVENCQ
QCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCVTDPCQADTIRNDITKTCTDEHNIS
RFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences H2LCY0
ENSORLP00000003773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]